Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WN79

Protein Details
Accession A0A1Y1WN79   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-89SELAPKKPVRSKPPKGHKQQRTYAEKQHydrophilic
NLS Segment(s)
PositionSequence
68-80KKPVRSKPPKGHK
Subcellular Location(s) mito 16.5, cyto_mito 9.5, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MATVRKFSANILNHVKAEHAETAFKVSFVNGHWRPPHFSLRRQAELRKACLVQGIDPTSIGMSELAPKKPVRSKPPKGHKQQRTYAEKQAMIQKNLDEMPEKIRKWKEDLAKEKEKNKSSLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.29
4 0.29
5 0.25
6 0.18
7 0.17
8 0.16
9 0.22
10 0.21
11 0.2
12 0.17
13 0.13
14 0.13
15 0.14
16 0.23
17 0.19
18 0.25
19 0.29
20 0.31
21 0.36
22 0.39
23 0.47
24 0.42
25 0.47
26 0.51
27 0.54
28 0.59
29 0.57
30 0.57
31 0.56
32 0.56
33 0.53
34 0.47
35 0.4
36 0.33
37 0.33
38 0.3
39 0.22
40 0.21
41 0.2
42 0.16
43 0.15
44 0.15
45 0.11
46 0.11
47 0.09
48 0.05
49 0.04
50 0.08
51 0.11
52 0.11
53 0.14
54 0.14
55 0.18
56 0.25
57 0.31
58 0.37
59 0.45
60 0.55
61 0.63
62 0.74
63 0.8
64 0.84
65 0.89
66 0.88
67 0.86
68 0.84
69 0.83
70 0.81
71 0.76
72 0.73
73 0.68
74 0.59
75 0.54
76 0.56
77 0.52
78 0.45
79 0.41
80 0.34
81 0.31
82 0.31
83 0.29
84 0.21
85 0.17
86 0.23
87 0.29
88 0.29
89 0.35
90 0.4
91 0.42
92 0.46
93 0.53
94 0.55
95 0.58
96 0.67
97 0.68
98 0.73
99 0.76
100 0.78
101 0.79
102 0.75
103 0.69