Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WMC2

Protein Details
Accession A0A1Y1WMC2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-75RPPSTRPKSLQLRQRRLNRRIQRTWHydrophilic
NLS Segment(s)
PositionSequence
40-70RRGRRLAWFRARPPSTRPKSLQLRQRRLNRR
Subcellular Location(s) mito 15, nucl 9, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
CDD cd00590  RRM_SF  
Amino Acid Sequences MESAAAALKAVELLNGHKADGKKIKATVSPEQVGDTWNIRRGRRLAWFRARPPSTRPKSLQLRQRRLNRRIQRTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.18
5 0.18
6 0.25
7 0.31
8 0.32
9 0.3
10 0.32
11 0.35
12 0.35
13 0.4
14 0.39
15 0.38
16 0.36
17 0.33
18 0.31
19 0.29
20 0.26
21 0.21
22 0.17
23 0.12
24 0.17
25 0.21
26 0.2
27 0.23
28 0.24
29 0.27
30 0.34
31 0.39
32 0.42
33 0.49
34 0.55
35 0.57
36 0.65
37 0.64
38 0.57
39 0.58
40 0.6
41 0.57
42 0.58
43 0.57
44 0.57
45 0.65
46 0.69
47 0.72
48 0.72
49 0.76
50 0.77
51 0.84
52 0.85
53 0.82
54 0.85
55 0.86