Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WBD9

Protein Details
Accession A0A1Y1WBD9   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
160-209KSPKVTKKMKMKLEKERREKERAERKEQQRLERERKKREKEEKKERELAKBasic
NLS Segment(s)
PositionSequence
59-63RGNRK
130-145EKKPANKTKDPRGAKR
159-208HKSPKVTKKMKMKLEKERREKERAERKEQQRLERERKKREKEEKKERELA
Subcellular Location(s) nucl 15, mito 9.5, cyto_mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013243  SCA7_dom  
IPR037804  SGF73  
Gene Ontology GO:0000124  C:SAGA complex  
Pfam View protein in Pfam  
PF08313  SCA7  
PROSITE View protein in PROSITE  
PS51505  SCA7  
Amino Acid Sequences MASSLNGLSAFTSARDWQSISSTHRGGEPPRLTWDMLKKAVGEEDKYQSKKNWSSTKGRGNRKAPIARRLDAEVLKKFGVYPEGAVSVAGCVNAHYLKEHQEQNCAVSTHKREEKKNTSAEPAAQASAGEKKPANKTKDPRGAKRLGSEALSEDEDEGHKSPKVTKKMKMKLEKERREKERAERKEQQRLERERKKREKEEKKERELAKQRQPLDLDKQCGVVSEPGSAPCSRSLTCKTHSMAMKRAVAGRRTWPSRAAPQQHAMRRLGAQAAKSGNAVRSAMAIALGGEAGAIDESFFDDSDEERGSDEEAEQVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.18
5 0.21
6 0.25
7 0.28
8 0.32
9 0.31
10 0.3
11 0.33
12 0.35
13 0.35
14 0.41
15 0.38
16 0.34
17 0.39
18 0.41
19 0.38
20 0.41
21 0.46
22 0.43
23 0.42
24 0.41
25 0.36
26 0.34
27 0.39
28 0.36
29 0.31
30 0.29
31 0.33
32 0.4
33 0.42
34 0.44
35 0.43
36 0.49
37 0.52
38 0.56
39 0.59
40 0.57
41 0.64
42 0.7
43 0.76
44 0.76
45 0.79
46 0.8
47 0.76
48 0.77
49 0.77
50 0.77
51 0.73
52 0.73
53 0.69
54 0.61
55 0.58
56 0.54
57 0.5
58 0.45
59 0.45
60 0.39
61 0.35
62 0.33
63 0.3
64 0.26
65 0.22
66 0.21
67 0.15
68 0.13
69 0.12
70 0.13
71 0.13
72 0.12
73 0.11
74 0.09
75 0.09
76 0.07
77 0.05
78 0.05
79 0.07
80 0.07
81 0.08
82 0.08
83 0.1
84 0.15
85 0.21
86 0.27
87 0.26
88 0.3
89 0.31
90 0.31
91 0.33
92 0.28
93 0.24
94 0.24
95 0.27
96 0.3
97 0.36
98 0.4
99 0.42
100 0.52
101 0.59
102 0.6
103 0.62
104 0.57
105 0.55
106 0.51
107 0.47
108 0.4
109 0.33
110 0.25
111 0.19
112 0.16
113 0.12
114 0.17
115 0.15
116 0.14
117 0.14
118 0.18
119 0.27
120 0.35
121 0.4
122 0.42
123 0.49
124 0.57
125 0.66
126 0.68
127 0.66
128 0.66
129 0.65
130 0.59
131 0.55
132 0.48
133 0.39
134 0.34
135 0.27
136 0.21
137 0.17
138 0.15
139 0.13
140 0.1
141 0.09
142 0.08
143 0.09
144 0.08
145 0.08
146 0.08
147 0.09
148 0.15
149 0.21
150 0.3
151 0.35
152 0.41
153 0.51
154 0.58
155 0.67
156 0.71
157 0.71
158 0.73
159 0.79
160 0.82
161 0.81
162 0.82
163 0.78
164 0.76
165 0.73
166 0.72
167 0.71
168 0.69
169 0.68
170 0.69
171 0.7
172 0.73
173 0.74
174 0.71
175 0.7
176 0.72
177 0.74
178 0.74
179 0.76
180 0.77
181 0.83
182 0.84
183 0.85
184 0.87
185 0.87
186 0.88
187 0.91
188 0.9
189 0.88
190 0.87
191 0.79
192 0.78
193 0.77
194 0.75
195 0.74
196 0.71
197 0.65
198 0.6
199 0.61
200 0.55
201 0.54
202 0.5
203 0.44
204 0.37
205 0.37
206 0.32
207 0.3
208 0.27
209 0.2
210 0.16
211 0.14
212 0.14
213 0.14
214 0.16
215 0.16
216 0.16
217 0.15
218 0.18
219 0.16
220 0.21
221 0.26
222 0.29
223 0.32
224 0.37
225 0.36
226 0.4
227 0.45
228 0.44
229 0.45
230 0.46
231 0.47
232 0.42
233 0.46
234 0.44
235 0.42
236 0.4
237 0.41
238 0.43
239 0.44
240 0.44
241 0.43
242 0.44
243 0.5
244 0.57
245 0.56
246 0.53
247 0.57
248 0.64
249 0.65
250 0.65
251 0.58
252 0.51
253 0.45
254 0.41
255 0.39
256 0.33
257 0.27
258 0.27
259 0.27
260 0.25
261 0.25
262 0.26
263 0.21
264 0.21
265 0.21
266 0.16
267 0.15
268 0.15
269 0.13
270 0.11
271 0.09
272 0.07
273 0.06
274 0.06
275 0.04
276 0.04
277 0.03
278 0.03
279 0.04
280 0.03
281 0.03
282 0.03
283 0.05
284 0.06
285 0.06
286 0.07
287 0.07
288 0.08
289 0.12
290 0.13
291 0.12
292 0.13
293 0.13
294 0.14
295 0.14
296 0.14