Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VZD1

Protein Details
Accession A0A1Y1VZD1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
23-59SRRGSRCRASGTRRRGRHRCRCRRGCHCRRASNKAVVBasic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSTLPRKTHSLHDCGRCGSRCSSRRGSRCRASGTRRRGRHRCRCRRGCHCRRASNKAVVADGDASDLRTHQHIVNQWVGHRVGHLHNHSLRVRRRNRGCMENLRQTAVDGWPWGVAEPGHGVVDYACKVVPVGRDRVQRILLRSGGEGECGEGEGRCELHDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.54
4 0.51
5 0.49
6 0.51
7 0.49
8 0.53
9 0.6
10 0.63
11 0.69
12 0.75
13 0.77
14 0.75
15 0.76
16 0.77
17 0.75
18 0.75
19 0.75
20 0.77
21 0.77
22 0.78
23 0.82
24 0.84
25 0.86
26 0.87
27 0.89
28 0.9
29 0.91
30 0.92
31 0.92
32 0.93
33 0.93
34 0.93
35 0.92
36 0.9
37 0.89
38 0.87
39 0.85
40 0.8
41 0.77
42 0.7
43 0.61
44 0.52
45 0.42
46 0.35
47 0.27
48 0.2
49 0.13
50 0.09
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.09
57 0.08
58 0.11
59 0.14
60 0.17
61 0.21
62 0.21
63 0.2
64 0.21
65 0.21
66 0.18
67 0.15
68 0.14
69 0.12
70 0.17
71 0.18
72 0.19
73 0.2
74 0.26
75 0.28
76 0.34
77 0.38
78 0.42
79 0.48
80 0.53
81 0.58
82 0.62
83 0.65
84 0.64
85 0.65
86 0.65
87 0.66
88 0.65
89 0.6
90 0.52
91 0.47
92 0.4
93 0.35
94 0.26
95 0.19
96 0.11
97 0.1
98 0.09
99 0.09
100 0.08
101 0.07
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.07
108 0.08
109 0.07
110 0.1
111 0.1
112 0.09
113 0.08
114 0.08
115 0.08
116 0.11
117 0.17
118 0.18
119 0.24
120 0.3
121 0.37
122 0.4
123 0.45
124 0.49
125 0.46
126 0.46
127 0.45
128 0.41
129 0.36
130 0.34
131 0.33
132 0.28
133 0.26
134 0.21
135 0.16
136 0.14
137 0.13
138 0.13
139 0.09
140 0.1
141 0.1
142 0.11