Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0EIL3

Protein Details
Accession H0EIL3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-63EEVPGRKKKVDKKVEKDKMEREBasic
NLS Segment(s)
PositionSequence
46-56GRKKKVDKKVE
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences MGNTPSHNVRGYARPKGELNPMKHGFWIKDSLLTHPRWKDMEEVPGRKKKVDKKVEKDKMEREMFQKGSIHGLGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.44
4 0.51
5 0.49
6 0.48
7 0.49
8 0.49
9 0.46
10 0.46
11 0.45
12 0.35
13 0.3
14 0.3
15 0.2
16 0.22
17 0.22
18 0.25
19 0.28
20 0.28
21 0.31
22 0.28
23 0.3
24 0.26
25 0.26
26 0.26
27 0.22
28 0.29
29 0.31
30 0.36
31 0.41
32 0.46
33 0.46
34 0.46
35 0.51
36 0.51
37 0.55
38 0.59
39 0.63
40 0.67
41 0.77
42 0.84
43 0.85
44 0.84
45 0.79
46 0.78
47 0.72
48 0.66
49 0.58
50 0.57
51 0.51
52 0.47
53 0.43
54 0.35
55 0.35