Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WMZ5

Protein Details
Accession A0A1Y1WMZ5    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-36ASVPSAKRRIQQAKKQLNEYEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 12.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR041569  AAA_lid_3  
IPR003959  ATPase_AAA_core  
IPR003960  ATPase_AAA_CS  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
PF17862  AAA_lid_3  
PROSITE View protein in PROSITE  
PS00674  AAA  
Amino Acid Sequences MDEDVGDADSAAKTPASVPSAKRRIQQAKKQLNEYEQRLVGSIVDPQSIPTGFSQVCVQPETVTTLQEIITLPMLRPEYFSQGVLKRHGVSGILLFGPPGTGKTMLAKAVAKESGSVVLNIRASDVYDKYVGEGEKLAEAVFTLARKLAPCVVFIDEVDALFSARSSGEPNKFRRDVMNQIMAEWDGMNTSRGNASRVMVMAATNRPFDLDDAILRRLPRRILVDLPGEKERAQILEIHLAGEAVEEGIDLAAISGRTQGFSGSDLKNLCVAAALAALRERVRQEVGDNGSMDKLRATRAVGGTISLGMRHFEQALKKVAASSSDQMESLMELRKWDKIYGDGAQERKRTHTIGFAGQPAEEESKASRDSPGLGEGGAAKADEDTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.17
4 0.21
5 0.26
6 0.36
7 0.46
8 0.5
9 0.54
10 0.59
11 0.66
12 0.72
13 0.77
14 0.77
15 0.79
16 0.81
17 0.83
18 0.78
19 0.76
20 0.74
21 0.69
22 0.65
23 0.56
24 0.5
25 0.43
26 0.38
27 0.3
28 0.22
29 0.22
30 0.16
31 0.16
32 0.15
33 0.15
34 0.18
35 0.17
36 0.18
37 0.13
38 0.17
39 0.16
40 0.17
41 0.19
42 0.19
43 0.21
44 0.21
45 0.21
46 0.17
47 0.18
48 0.23
49 0.2
50 0.18
51 0.16
52 0.16
53 0.15
54 0.16
55 0.16
56 0.1
57 0.13
58 0.13
59 0.12
60 0.16
61 0.18
62 0.16
63 0.19
64 0.2
65 0.23
66 0.23
67 0.25
68 0.26
69 0.29
70 0.33
71 0.33
72 0.34
73 0.29
74 0.28
75 0.28
76 0.23
77 0.18
78 0.16
79 0.15
80 0.12
81 0.11
82 0.1
83 0.09
84 0.09
85 0.08
86 0.07
87 0.07
88 0.08
89 0.08
90 0.12
91 0.14
92 0.14
93 0.17
94 0.17
95 0.16
96 0.19
97 0.19
98 0.16
99 0.15
100 0.15
101 0.15
102 0.14
103 0.14
104 0.12
105 0.14
106 0.14
107 0.14
108 0.14
109 0.11
110 0.11
111 0.13
112 0.13
113 0.12
114 0.12
115 0.12
116 0.12
117 0.15
118 0.14
119 0.12
120 0.12
121 0.1
122 0.1
123 0.1
124 0.09
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.08
134 0.09
135 0.13
136 0.13
137 0.13
138 0.15
139 0.16
140 0.15
141 0.15
142 0.16
143 0.11
144 0.1
145 0.1
146 0.08
147 0.06
148 0.06
149 0.06
150 0.04
151 0.04
152 0.04
153 0.07
154 0.13
155 0.2
156 0.26
157 0.31
158 0.38
159 0.39
160 0.39
161 0.4
162 0.39
163 0.4
164 0.38
165 0.41
166 0.34
167 0.33
168 0.33
169 0.28
170 0.24
171 0.16
172 0.11
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.07
179 0.08
180 0.09
181 0.1
182 0.1
183 0.1
184 0.1
185 0.1
186 0.08
187 0.08
188 0.09
189 0.1
190 0.11
191 0.1
192 0.1
193 0.1
194 0.1
195 0.1
196 0.1
197 0.08
198 0.09
199 0.11
200 0.12
201 0.14
202 0.14
203 0.15
204 0.16
205 0.16
206 0.18
207 0.19
208 0.21
209 0.21
210 0.24
211 0.3
212 0.29
213 0.32
214 0.3
215 0.27
216 0.24
217 0.23
218 0.2
219 0.14
220 0.12
221 0.12
222 0.12
223 0.15
224 0.15
225 0.14
226 0.14
227 0.13
228 0.12
229 0.1
230 0.08
231 0.03
232 0.03
233 0.02
234 0.02
235 0.02
236 0.02
237 0.02
238 0.02
239 0.03
240 0.03
241 0.03
242 0.06
243 0.06
244 0.07
245 0.07
246 0.08
247 0.07
248 0.09
249 0.15
250 0.13
251 0.17
252 0.17
253 0.17
254 0.19
255 0.18
256 0.16
257 0.11
258 0.1
259 0.07
260 0.08
261 0.07
262 0.06
263 0.06
264 0.08
265 0.08
266 0.1
267 0.11
268 0.12
269 0.13
270 0.13
271 0.14
272 0.2
273 0.23
274 0.25
275 0.24
276 0.23
277 0.23
278 0.22
279 0.21
280 0.16
281 0.13
282 0.12
283 0.14
284 0.15
285 0.18
286 0.19
287 0.22
288 0.2
289 0.19
290 0.18
291 0.17
292 0.16
293 0.11
294 0.1
295 0.09
296 0.1
297 0.1
298 0.11
299 0.13
300 0.17
301 0.21
302 0.27
303 0.27
304 0.26
305 0.27
306 0.27
307 0.26
308 0.26
309 0.24
310 0.22
311 0.21
312 0.21
313 0.2
314 0.19
315 0.17
316 0.16
317 0.18
318 0.14
319 0.16
320 0.18
321 0.23
322 0.25
323 0.25
324 0.25
325 0.23
326 0.27
327 0.28
328 0.34
329 0.35
330 0.41
331 0.46
332 0.49
333 0.47
334 0.49
335 0.49
336 0.43
337 0.39
338 0.4
339 0.38
340 0.4
341 0.42
342 0.4
343 0.37
344 0.34
345 0.33
346 0.28
347 0.27
348 0.2
349 0.18
350 0.16
351 0.2
352 0.21
353 0.21
354 0.21
355 0.19
356 0.22
357 0.22
358 0.23
359 0.19
360 0.17
361 0.17
362 0.17
363 0.16
364 0.13
365 0.11
366 0.08
367 0.09