Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WE11

Protein Details
Accession A0A1Y1WE11   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKSIRSKSKIRNRNILRETHydrophilic
26-49EAERIKRLAEKQKKQKQQETQQAGHydrophilic
65-98QTESSMRKKRGKSQKRGIKKITVRNKKGRIMSKNHydrophilic
NLS Segment(s)
PositionSequence
71-110RKKRGKSQKRGIKKITVRNKKGRIMSKNVVKWTKQSRFKK
Subcellular Location(s) mito 18.5, mito_nucl 13.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MGKSIRSKSKIRNRNILRETVFGPAEAERIKRLAEKQKKQKQQETQQAGTEADDSMAVDGSEAAQTESSMRKKRGKSQKRGIKKITVRNKKGRIMSKNVVKWTKQSRFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.75
4 0.67
5 0.61
6 0.54
7 0.48
8 0.4
9 0.29
10 0.26
11 0.18
12 0.18
13 0.17
14 0.16
15 0.13
16 0.13
17 0.14
18 0.16
19 0.23
20 0.31
21 0.4
22 0.49
23 0.59
24 0.68
25 0.77
26 0.81
27 0.83
28 0.82
29 0.82
30 0.82
31 0.79
32 0.71
33 0.63
34 0.57
35 0.48
36 0.38
37 0.28
38 0.18
39 0.1
40 0.08
41 0.06
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.11
55 0.16
56 0.22
57 0.27
58 0.34
59 0.38
60 0.48
61 0.58
62 0.64
63 0.69
64 0.75
65 0.8
66 0.84
67 0.89
68 0.85
69 0.84
70 0.82
71 0.81
72 0.81
73 0.82
74 0.8
75 0.81
76 0.83
77 0.81
78 0.81
79 0.8
80 0.77
81 0.75
82 0.75
83 0.75
84 0.73
85 0.75
86 0.72
87 0.64
88 0.65
89 0.67
90 0.68