Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WBK1

Protein Details
Accession A0A1Y1WBK1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
97-116RLPPRCSLGSKKRSDRRAGGBasic
NLS Segment(s)
Subcellular Location(s) extr 9, mito 5, cyto 3, plas 3, mito_nucl 3, pero 2, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MCAFGEDTSPIVLLSCILPGTACPVLPFAKWSEALLGSCLHSKCLRLAATMLLILWRRPGLSEPPKERCTKSLLQESNAHKCGRSCPQLPREKNESRLPPRCSLGSKKRSDRRAGGSCMGVPEIAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.06
7 0.11
8 0.11
9 0.1
10 0.1
11 0.13
12 0.14
13 0.14
14 0.16
15 0.14
16 0.16
17 0.16
18 0.16
19 0.16
20 0.16
21 0.16
22 0.16
23 0.14
24 0.12
25 0.16
26 0.16
27 0.15
28 0.15
29 0.15
30 0.16
31 0.2
32 0.19
33 0.15
34 0.16
35 0.15
36 0.15
37 0.14
38 0.12
39 0.09
40 0.09
41 0.08
42 0.08
43 0.07
44 0.07
45 0.07
46 0.09
47 0.15
48 0.23
49 0.3
50 0.35
51 0.41
52 0.45
53 0.47
54 0.47
55 0.4
56 0.39
57 0.36
58 0.37
59 0.4
60 0.38
61 0.39
62 0.45
63 0.48
64 0.49
65 0.48
66 0.42
67 0.33
68 0.32
69 0.34
70 0.34
71 0.36
72 0.33
73 0.39
74 0.48
75 0.58
76 0.61
77 0.63
78 0.64
79 0.62
80 0.64
81 0.64
82 0.64
83 0.64
84 0.69
85 0.67
86 0.63
87 0.61
88 0.58
89 0.56
90 0.56
91 0.57
92 0.58
93 0.62
94 0.68
95 0.74
96 0.78
97 0.8
98 0.78
99 0.77
100 0.75
101 0.72
102 0.66
103 0.6
104 0.53
105 0.47
106 0.4