Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1W0J8

Protein Details
Accession A0A1Y1W0J8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-56MPVLTRTKNTCRPKNMKRINKLLLHydrophilic
NLS Segment(s)
PositionSequence
78-95RAPNPRKGKSGSATPTKK
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
IPR001374  R3H_dom  
IPR036867  R3H_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01585  G-patch  
PF01424  R3H  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
PS51061  R3H  
CDD cd02325  R3H  
Amino Acid Sequences LQPLNTFERRIVHILASEFNVKSKSKGGKSNRMPVLTRTKNTCRPKNMKRINKLLLLWDEGGLIPEYWSGGRKASWDRAPNPRKGKSGSATPTKKKLVGEGAPVVGESNIGHQMLKQMGWAPGQGLGAGEEGRATPVDVMIRTGRQGLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.25
5 0.22
6 0.22
7 0.24
8 0.21
9 0.21
10 0.27
11 0.33
12 0.34
13 0.44
14 0.51
15 0.58
16 0.65
17 0.73
18 0.72
19 0.67
20 0.63
21 0.6
22 0.62
23 0.58
24 0.54
25 0.52
26 0.53
27 0.59
28 0.67
29 0.69
30 0.68
31 0.72
32 0.77
33 0.81
34 0.84
35 0.83
36 0.81
37 0.82
38 0.77
39 0.71
40 0.63
41 0.56
42 0.47
43 0.4
44 0.33
45 0.24
46 0.19
47 0.14
48 0.14
49 0.1
50 0.08
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.09
60 0.12
61 0.17
62 0.22
63 0.26
64 0.3
65 0.4
66 0.44
67 0.5
68 0.54
69 0.53
70 0.52
71 0.5
72 0.51
73 0.43
74 0.46
75 0.44
76 0.47
77 0.5
78 0.5
79 0.54
80 0.51
81 0.51
82 0.43
83 0.41
84 0.38
85 0.33
86 0.34
87 0.29
88 0.27
89 0.24
90 0.24
91 0.2
92 0.13
93 0.11
94 0.06
95 0.07
96 0.08
97 0.08
98 0.08
99 0.08
100 0.12
101 0.12
102 0.12
103 0.11
104 0.12
105 0.14
106 0.15
107 0.15
108 0.13
109 0.14
110 0.14
111 0.13
112 0.1
113 0.09
114 0.09
115 0.09
116 0.08
117 0.06
118 0.06
119 0.07
120 0.07
121 0.07
122 0.06
123 0.08
124 0.11
125 0.11
126 0.14
127 0.16
128 0.17
129 0.18
130 0.2