Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WJN8

Protein Details
Accession A0A1Y1WJN8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
379-406GYRRPLRCWICLRRRWPGRGHHHRGPLSBasic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 4.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002155  Thiolase  
IPR016039  Thiolase-like  
IPR020616  Thiolase_N  
Gene Ontology GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF00108  Thiolase_N  
CDD cd00751  thiolase  
Amino Acid Sequences MSSQAFIVAAKRTPFGAFGGKLKDLSANELGGLAAKAALAQLPASAQAHLTQSTSERQSVIFGNVAQTSTDAPYLARHVGLRAGLPITTPAYTVNRLCTSGFQTIINAVQEIKVGDVDVAVTGGSESMSQAPYVLRNVRWGTKFGPEYLKMEDALAASLTDRYPEVVPMAITAERLADQYSVSRTDCDEFALRSQTLWAQAQESGVYDAEIAPVEVKVKRAVEQVTKDEHPRPKTTIEGLAKLPAVFKKDGVVSAGNASGISDGGSACDRCWRAVRQAARHPAARPHRGLPHRRCRPGTHGHRPCRCHPGRPGQVEPDHGPDGHHRNQRGLCCPGPVVRQGSGHRSCSPQRVRWCHCPGPSARCLGIAHHGPPGAPPEGYRRPLRCWICLRRRWPGRGHHHRGPLSLLLEDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.26
4 0.24
5 0.28
6 0.32
7 0.32
8 0.32
9 0.31
10 0.33
11 0.27
12 0.3
13 0.28
14 0.22
15 0.21
16 0.21
17 0.2
18 0.15
19 0.15
20 0.09
21 0.06
22 0.05
23 0.05
24 0.05
25 0.06
26 0.05
27 0.05
28 0.06
29 0.06
30 0.09
31 0.1
32 0.1
33 0.1
34 0.12
35 0.14
36 0.14
37 0.15
38 0.14
39 0.15
40 0.21
41 0.24
42 0.23
43 0.21
44 0.21
45 0.23
46 0.23
47 0.23
48 0.19
49 0.16
50 0.18
51 0.18
52 0.18
53 0.15
54 0.14
55 0.13
56 0.13
57 0.13
58 0.1
59 0.09
60 0.11
61 0.14
62 0.14
63 0.14
64 0.13
65 0.13
66 0.16
67 0.16
68 0.15
69 0.13
70 0.13
71 0.12
72 0.12
73 0.12
74 0.12
75 0.11
76 0.11
77 0.12
78 0.14
79 0.18
80 0.19
81 0.22
82 0.22
83 0.23
84 0.24
85 0.24
86 0.25
87 0.25
88 0.25
89 0.2
90 0.19
91 0.19
92 0.2
93 0.18
94 0.13
95 0.1
96 0.09
97 0.1
98 0.09
99 0.09
100 0.07
101 0.06
102 0.06
103 0.05
104 0.05
105 0.04
106 0.04
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.05
115 0.06
116 0.06
117 0.07
118 0.07
119 0.09
120 0.13
121 0.15
122 0.14
123 0.2
124 0.22
125 0.28
126 0.28
127 0.3
128 0.28
129 0.32
130 0.33
131 0.3
132 0.33
133 0.29
134 0.3
135 0.3
136 0.29
137 0.22
138 0.21
139 0.19
140 0.13
141 0.12
142 0.09
143 0.07
144 0.06
145 0.07
146 0.06
147 0.06
148 0.05
149 0.07
150 0.07
151 0.07
152 0.08
153 0.07
154 0.07
155 0.07
156 0.09
157 0.07
158 0.07
159 0.07
160 0.06
161 0.06
162 0.07
163 0.07
164 0.06
165 0.06
166 0.07
167 0.09
168 0.1
169 0.1
170 0.1
171 0.11
172 0.12
173 0.12
174 0.12
175 0.12
176 0.11
177 0.12
178 0.14
179 0.13
180 0.12
181 0.13
182 0.12
183 0.13
184 0.13
185 0.12
186 0.1
187 0.1
188 0.11
189 0.1
190 0.1
191 0.08
192 0.07
193 0.06
194 0.05
195 0.05
196 0.05
197 0.05
198 0.04
199 0.04
200 0.04
201 0.06
202 0.06
203 0.07
204 0.09
205 0.1
206 0.12
207 0.14
208 0.17
209 0.21
210 0.24
211 0.26
212 0.28
213 0.29
214 0.31
215 0.34
216 0.38
217 0.37
218 0.36
219 0.36
220 0.33
221 0.34
222 0.33
223 0.35
224 0.31
225 0.3
226 0.28
227 0.27
228 0.25
229 0.23
230 0.22
231 0.15
232 0.17
233 0.14
234 0.14
235 0.14
236 0.14
237 0.15
238 0.15
239 0.14
240 0.11
241 0.12
242 0.12
243 0.1
244 0.09
245 0.08
246 0.06
247 0.05
248 0.05
249 0.04
250 0.04
251 0.05
252 0.06
253 0.07
254 0.07
255 0.12
256 0.13
257 0.14
258 0.18
259 0.2
260 0.25
261 0.32
262 0.39
263 0.42
264 0.5
265 0.57
266 0.56
267 0.56
268 0.52
269 0.54
270 0.56
271 0.55
272 0.49
273 0.45
274 0.51
275 0.56
276 0.65
277 0.66
278 0.69
279 0.72
280 0.77
281 0.76
282 0.72
283 0.71
284 0.72
285 0.72
286 0.72
287 0.73
288 0.75
289 0.78
290 0.79
291 0.76
292 0.76
293 0.69
294 0.65
295 0.64
296 0.65
297 0.67
298 0.68
299 0.67
300 0.64
301 0.63
302 0.6
303 0.53
304 0.48
305 0.4
306 0.33
307 0.3
308 0.3
309 0.34
310 0.38
311 0.42
312 0.37
313 0.43
314 0.48
315 0.52
316 0.51
317 0.5
318 0.43
319 0.4
320 0.4
321 0.38
322 0.36
323 0.36
324 0.33
325 0.3
326 0.34
327 0.35
328 0.42
329 0.43
330 0.44
331 0.42
332 0.44
333 0.46
334 0.51
335 0.55
336 0.54
337 0.59
338 0.65
339 0.7
340 0.75
341 0.79
342 0.76
343 0.71
344 0.71
345 0.67
346 0.66
347 0.62
348 0.57
349 0.49
350 0.44
351 0.42
352 0.36
353 0.37
354 0.33
355 0.3
356 0.29
357 0.28
358 0.25
359 0.26
360 0.28
361 0.23
362 0.19
363 0.19
364 0.24
365 0.32
366 0.37
367 0.44
368 0.43
369 0.48
370 0.58
371 0.61
372 0.6
373 0.62
374 0.68
375 0.71
376 0.76
377 0.77
378 0.78
379 0.83
380 0.81
381 0.8
382 0.79
383 0.8
384 0.82
385 0.84
386 0.82
387 0.83
388 0.78
389 0.72
390 0.66
391 0.6
392 0.51