Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WC66

Protein Details
Accession A0A1Y1WC66    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
129-151GGIDRKLSFRRRRHNRHEDKAGLBasic
NLS Segment(s)
PositionSequence
137-142FRRRRH
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028375  KA1/Ssp2_C  
IPR001772  KA1_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF02149  KA1  
PROSITE View protein in PROSITE  
PS50032  KA1  
Amino Acid Sequences MPTGLSATRGGIPRLLLTYLRSKAEEQQAAAAAVEGISKAPRADEYLKSVSLKALFSATTTSTRSPSEIRAGLINVMNTMHLRFHEGKGYFTCSMVTSVGPTNLQDAVYPMHADAASKNSGLHKSMRLGGIDRKLSFRRRRHNRHEDKAGLIDSEAPMAVPGGGSGPHSIAESGVSENREVAVAENAKGISVCFQIFMVRVPLLQLYGLQFRRVSGPTWKYKDICSEILERLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.18
4 0.19
5 0.26
6 0.28
7 0.29
8 0.3
9 0.3
10 0.35
11 0.43
12 0.43
13 0.36
14 0.35
15 0.34
16 0.33
17 0.3
18 0.23
19 0.14
20 0.1
21 0.09
22 0.06
23 0.05
24 0.05
25 0.06
26 0.06
27 0.07
28 0.08
29 0.13
30 0.17
31 0.2
32 0.26
33 0.29
34 0.31
35 0.31
36 0.3
37 0.28
38 0.25
39 0.23
40 0.17
41 0.15
42 0.13
43 0.12
44 0.14
45 0.13
46 0.14
47 0.16
48 0.16
49 0.17
50 0.18
51 0.2
52 0.19
53 0.2
54 0.23
55 0.22
56 0.22
57 0.21
58 0.21
59 0.21
60 0.2
61 0.17
62 0.12
63 0.11
64 0.1
65 0.09
66 0.09
67 0.08
68 0.07
69 0.12
70 0.14
71 0.15
72 0.21
73 0.21
74 0.23
75 0.24
76 0.28
77 0.24
78 0.22
79 0.21
80 0.15
81 0.16
82 0.14
83 0.12
84 0.09
85 0.09
86 0.1
87 0.09
88 0.09
89 0.09
90 0.09
91 0.09
92 0.07
93 0.07
94 0.08
95 0.08
96 0.08
97 0.06
98 0.07
99 0.07
100 0.07
101 0.06
102 0.08
103 0.09
104 0.09
105 0.09
106 0.1
107 0.11
108 0.13
109 0.14
110 0.13
111 0.14
112 0.17
113 0.18
114 0.16
115 0.17
116 0.2
117 0.23
118 0.25
119 0.23
120 0.25
121 0.28
122 0.37
123 0.44
124 0.48
125 0.54
126 0.62
127 0.72
128 0.79
129 0.86
130 0.87
131 0.87
132 0.87
133 0.79
134 0.7
135 0.63
136 0.52
137 0.41
138 0.3
139 0.23
140 0.14
141 0.11
142 0.09
143 0.06
144 0.05
145 0.05
146 0.05
147 0.03
148 0.03
149 0.03
150 0.04
151 0.05
152 0.05
153 0.06
154 0.06
155 0.07
156 0.07
157 0.06
158 0.07
159 0.07
160 0.08
161 0.1
162 0.11
163 0.11
164 0.11
165 0.11
166 0.11
167 0.1
168 0.09
169 0.13
170 0.13
171 0.13
172 0.15
173 0.15
174 0.14
175 0.14
176 0.13
177 0.1
178 0.1
179 0.1
180 0.09
181 0.09
182 0.11
183 0.11
184 0.13
185 0.13
186 0.12
187 0.12
188 0.12
189 0.13
190 0.12
191 0.11
192 0.11
193 0.11
194 0.19
195 0.2
196 0.22
197 0.21
198 0.22
199 0.26
200 0.26
201 0.27
202 0.29
203 0.36
204 0.44
205 0.5
206 0.56
207 0.53
208 0.55
209 0.61
210 0.57
211 0.52
212 0.46
213 0.44
214 0.44