Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1W4M7

Protein Details
Accession A0A1Y1W4M7   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKKGKSGKSKKGGNSKPAAPKPBasic
340-359KEEPHKRTGHGDKPPRKGLVBasic
NLS Segment(s)
PositionSequence
3-22KKGKSGKSKKGGNSKPAAPK
330-357EEPAKAKEPVKEEPHKRTGHGDKPPRKG
Subcellular Location(s) mito 16, cyto 7.5, cyto_nucl 5.5, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MAKKGKSGKSKKGGNSKPAAPKPEVAPVVAEEVKQQELQVEEAVAEEPKVEETVEETAEETAPTEESKEEAAAPAAEEPAEVEEPAEAEEPVMAEESAKVEEPTKAEEPTKVEEPAKAEEPTKVEEPAKAEEPTKVEEPAFEIPSLGNVEAIVAAGAPAPMPIDRSEPKAEEVKAKEPAKVEEPVLAVEEPVKAEEPVKVEEEVAAPAVEEPAKVEEVAAPVVEEPAKVEEPTKVEEPAKVEEPAAVEPVVEEPVPAAEEPVKAEEPAKVEEVAASAVEEPAKVEEPTKVEEPAKVEEPAAVEPVAKEPVPAAEESVKAEPAKVEEPKAEEPAKAKEPVKEEPHKRTGHGDKPPRKGLVNRLIDFFGGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.8
4 0.8
5 0.78
6 0.75
7 0.67
8 0.63
9 0.57
10 0.58
11 0.5
12 0.4
13 0.34
14 0.3
15 0.32
16 0.29
17 0.26
18 0.19
19 0.2
20 0.21
21 0.2
22 0.19
23 0.15
24 0.16
25 0.17
26 0.16
27 0.13
28 0.11
29 0.12
30 0.12
31 0.1
32 0.08
33 0.07
34 0.07
35 0.07
36 0.08
37 0.07
38 0.06
39 0.09
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.12
46 0.12
47 0.1
48 0.08
49 0.08
50 0.08
51 0.09
52 0.08
53 0.09
54 0.1
55 0.1
56 0.1
57 0.1
58 0.11
59 0.09
60 0.1
61 0.1
62 0.09
63 0.08
64 0.07
65 0.07
66 0.09
67 0.09
68 0.08
69 0.07
70 0.07
71 0.07
72 0.09
73 0.09
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.05
81 0.05
82 0.05
83 0.07
84 0.07
85 0.08
86 0.08
87 0.09
88 0.11
89 0.12
90 0.17
91 0.18
92 0.19
93 0.2
94 0.22
95 0.24
96 0.27
97 0.28
98 0.26
99 0.25
100 0.25
101 0.27
102 0.27
103 0.27
104 0.24
105 0.22
106 0.22
107 0.23
108 0.24
109 0.23
110 0.22
111 0.2
112 0.2
113 0.23
114 0.24
115 0.25
116 0.23
117 0.22
118 0.22
119 0.23
120 0.24
121 0.23
122 0.2
123 0.17
124 0.16
125 0.19
126 0.19
127 0.18
128 0.15
129 0.14
130 0.12
131 0.14
132 0.15
133 0.11
134 0.07
135 0.06
136 0.06
137 0.06
138 0.06
139 0.04
140 0.02
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.05
149 0.06
150 0.1
151 0.11
152 0.16
153 0.18
154 0.18
155 0.2
156 0.23
157 0.24
158 0.25
159 0.27
160 0.27
161 0.33
162 0.33
163 0.33
164 0.3
165 0.31
166 0.28
167 0.27
168 0.23
169 0.17
170 0.17
171 0.15
172 0.14
173 0.12
174 0.09
175 0.08
176 0.08
177 0.06
178 0.06
179 0.06
180 0.05
181 0.06
182 0.08
183 0.09
184 0.11
185 0.12
186 0.12
187 0.11
188 0.12
189 0.12
190 0.1
191 0.09
192 0.07
193 0.05
194 0.05
195 0.06
196 0.05
197 0.04
198 0.05
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.07
205 0.08
206 0.07
207 0.06
208 0.05
209 0.06
210 0.06
211 0.05
212 0.05
213 0.07
214 0.08
215 0.08
216 0.09
217 0.11
218 0.13
219 0.16
220 0.17
221 0.17
222 0.17
223 0.19
224 0.21
225 0.22
226 0.22
227 0.19
228 0.18
229 0.17
230 0.17
231 0.16
232 0.15
233 0.11
234 0.09
235 0.08
236 0.09
237 0.09
238 0.07
239 0.06
240 0.05
241 0.05
242 0.06
243 0.06
244 0.06
245 0.07
246 0.08
247 0.09
248 0.12
249 0.12
250 0.12
251 0.13
252 0.14
253 0.15
254 0.17
255 0.17
256 0.14
257 0.14
258 0.14
259 0.13
260 0.12
261 0.09
262 0.07
263 0.06
264 0.06
265 0.07
266 0.06
267 0.06
268 0.07
269 0.09
270 0.09
271 0.1
272 0.11
273 0.13
274 0.17
275 0.17
276 0.18
277 0.17
278 0.19
279 0.21
280 0.22
281 0.22
282 0.19
283 0.18
284 0.17
285 0.17
286 0.16
287 0.15
288 0.12
289 0.1
290 0.1
291 0.12
292 0.14
293 0.12
294 0.12
295 0.1
296 0.13
297 0.14
298 0.14
299 0.15
300 0.15
301 0.16
302 0.19
303 0.2
304 0.2
305 0.19
306 0.19
307 0.17
308 0.18
309 0.24
310 0.24
311 0.25
312 0.25
313 0.31
314 0.34
315 0.39
316 0.37
317 0.33
318 0.34
319 0.38
320 0.4
321 0.41
322 0.4
323 0.39
324 0.43
325 0.49
326 0.55
327 0.58
328 0.62
329 0.65
330 0.71
331 0.68
332 0.65
333 0.67
334 0.67
335 0.66
336 0.68
337 0.7
338 0.7
339 0.77
340 0.82
341 0.76
342 0.72
343 0.69
344 0.69
345 0.69
346 0.69
347 0.62
348 0.58
349 0.55
350 0.5