Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WDE3

Protein Details
Accession A0A1Y1WDE3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
180-200CPPEADKARQRRRQAVRLLQSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, nucl 10, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039773  BAG_chaperone_regulator  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS51035  BAG  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MTAPPLVLQWGRERYLLKYEENDLQDTTLGQFKEVCREVTGVPVNSMKIIFSGATLKEDNVTLGRYGVYTGATMKMLGRKHGSEKSAPVTAEEREENALIHKIDHITNEASDLLLSRMQAYLADAQLFIDQFLSTVHENSEHGEAMAEIRAAEKKKLHDSYLFINETLMQSLLKVDCVECPPEADKARQRRRQAVRLLQSWMDQMDRKRDAVKEAEAKLGNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.4
4 0.35
5 0.33
6 0.35
7 0.39
8 0.4
9 0.38
10 0.31
11 0.28
12 0.25
13 0.22
14 0.2
15 0.17
16 0.15
17 0.13
18 0.16
19 0.16
20 0.24
21 0.26
22 0.25
23 0.22
24 0.25
25 0.24
26 0.28
27 0.33
28 0.25
29 0.25
30 0.25
31 0.24
32 0.23
33 0.23
34 0.15
35 0.1
36 0.1
37 0.08
38 0.07
39 0.11
40 0.11
41 0.14
42 0.14
43 0.14
44 0.14
45 0.14
46 0.14
47 0.11
48 0.12
49 0.09
50 0.09
51 0.09
52 0.08
53 0.08
54 0.08
55 0.07
56 0.06
57 0.07
58 0.08
59 0.08
60 0.08
61 0.09
62 0.13
63 0.13
64 0.16
65 0.18
66 0.19
67 0.24
68 0.28
69 0.3
70 0.28
71 0.3
72 0.3
73 0.31
74 0.29
75 0.25
76 0.22
77 0.2
78 0.2
79 0.18
80 0.15
81 0.13
82 0.13
83 0.11
84 0.11
85 0.12
86 0.1
87 0.09
88 0.09
89 0.1
90 0.1
91 0.1
92 0.11
93 0.1
94 0.09
95 0.1
96 0.09
97 0.08
98 0.07
99 0.07
100 0.06
101 0.06
102 0.06
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.08
114 0.08
115 0.06
116 0.05
117 0.05
118 0.04
119 0.05
120 0.07
121 0.07
122 0.07
123 0.07
124 0.08
125 0.08
126 0.1
127 0.11
128 0.09
129 0.08
130 0.08
131 0.08
132 0.08
133 0.08
134 0.06
135 0.05
136 0.06
137 0.1
138 0.11
139 0.14
140 0.16
141 0.2
142 0.29
143 0.32
144 0.33
145 0.33
146 0.35
147 0.38
148 0.43
149 0.4
150 0.31
151 0.28
152 0.27
153 0.24
154 0.22
155 0.16
156 0.08
157 0.07
158 0.09
159 0.09
160 0.09
161 0.09
162 0.09
163 0.11
164 0.14
165 0.16
166 0.14
167 0.17
168 0.17
169 0.23
170 0.26
171 0.3
172 0.36
173 0.45
174 0.55
175 0.61
176 0.67
177 0.71
178 0.78
179 0.8
180 0.81
181 0.81
182 0.79
183 0.74
184 0.72
185 0.63
186 0.55
187 0.48
188 0.39
189 0.32
190 0.28
191 0.28
192 0.33
193 0.34
194 0.35
195 0.38
196 0.39
197 0.41
198 0.42
199 0.46
200 0.45
201 0.44
202 0.49