Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1W2A6

Protein Details
Accession A0A1Y1W2A6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-47QSPPTRRKRFSLQTRHNNNSKHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, mito 3, E.R. 2, golg 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTMPTSASTPRGAGTARTNAPNPLWEQSPPTRRKRFSLQTRHNNNSKRCVHGVVGYHVCFTRIRSPVRSWMNAFLCIIFLLWNGLFMLFHFYCVDNSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.28
4 0.31
5 0.31
6 0.32
7 0.32
8 0.31
9 0.29
10 0.24
11 0.23
12 0.2
13 0.25
14 0.3
15 0.39
16 0.44
17 0.51
18 0.57
19 0.58
20 0.62
21 0.66
22 0.68
23 0.69
24 0.73
25 0.74
26 0.75
27 0.82
28 0.82
29 0.8
30 0.77
31 0.69
32 0.68
33 0.6
34 0.53
35 0.46
36 0.42
37 0.36
38 0.32
39 0.31
40 0.26
41 0.27
42 0.23
43 0.22
44 0.2
45 0.2
46 0.16
47 0.17
48 0.2
49 0.21
50 0.25
51 0.29
52 0.32
53 0.4
54 0.45
55 0.46
56 0.41
57 0.44
58 0.43
59 0.4
60 0.37
61 0.28
62 0.23
63 0.19
64 0.17
65 0.09
66 0.07
67 0.08
68 0.07
69 0.08
70 0.08
71 0.08
72 0.07
73 0.07
74 0.16
75 0.13
76 0.15
77 0.15
78 0.16