Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WLZ0

Protein Details
Accession A0A1Y1WLZ0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
141-166LGKRWNPSVCLKRPKKKEAHRALDDIHydrophilic
NLS Segment(s)
PositionSequence
154-156PKK
Subcellular Location(s) nucl 9.5, cysk 9, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR022894  Oligoribonuclease  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0000175  F:3'-5'-RNA exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF00929  RNase_T  
CDD cd06135  Orn  
Amino Acid Sequences MSAANPPLVWIDCEMTGLDYNNDTIIEIACIITDGDLSTLEQGEDIIIHHPKAVMDSMNEWCIEHHGKSGLTQAVLDSKVTMAEAEERVLALVKRHCPTPRTAILAGNSVHADRAFLYRLMPKLNEYLHYRIIDVSSIGELGKRWNPSVCLKRPKKKEAHRALDDILESIEELRYYQKNLFKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.14
5 0.13
6 0.12
7 0.12
8 0.12
9 0.11
10 0.1
11 0.09
12 0.08
13 0.07
14 0.07
15 0.06
16 0.05
17 0.06
18 0.05
19 0.05
20 0.05
21 0.04
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.08
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.11
40 0.12
41 0.1
42 0.1
43 0.12
44 0.14
45 0.15
46 0.15
47 0.13
48 0.12
49 0.15
50 0.16
51 0.14
52 0.13
53 0.14
54 0.14
55 0.15
56 0.19
57 0.16
58 0.13
59 0.13
60 0.12
61 0.12
62 0.13
63 0.12
64 0.08
65 0.07
66 0.07
67 0.07
68 0.06
69 0.04
70 0.06
71 0.06
72 0.07
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.1
80 0.14
81 0.15
82 0.18
83 0.2
84 0.21
85 0.25
86 0.29
87 0.3
88 0.3
89 0.3
90 0.3
91 0.29
92 0.31
93 0.28
94 0.22
95 0.18
96 0.13
97 0.13
98 0.1
99 0.09
100 0.07
101 0.08
102 0.09
103 0.08
104 0.1
105 0.13
106 0.15
107 0.17
108 0.16
109 0.16
110 0.19
111 0.2
112 0.22
113 0.23
114 0.26
115 0.28
116 0.28
117 0.27
118 0.24
119 0.23
120 0.19
121 0.15
122 0.12
123 0.08
124 0.07
125 0.07
126 0.07
127 0.07
128 0.1
129 0.15
130 0.16
131 0.17
132 0.19
133 0.23
134 0.32
135 0.42
136 0.47
137 0.54
138 0.62
139 0.7
140 0.78
141 0.84
142 0.85
143 0.86
144 0.88
145 0.88
146 0.88
147 0.84
148 0.8
149 0.72
150 0.64
151 0.54
152 0.44
153 0.33
154 0.22
155 0.16
156 0.12
157 0.11
158 0.08
159 0.08
160 0.12
161 0.15
162 0.18
163 0.24