Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WCU6

Protein Details
Accession A0A1Y1WCU6   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-35APLLHSCERCRQKKRKCSGDKPACTWCRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSLQLNSAPLLHSCERCRQKKRKCSGDKPACTWCRKHNAICEYRQSIRIRKQLDALAPRWRQSDPMSRWQAGRVFAHSIDGAQQHHRSALGAISP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.45
3 0.53
4 0.63
5 0.67
6 0.74
7 0.8
8 0.87
9 0.88
10 0.89
11 0.9
12 0.91
13 0.91
14 0.87
15 0.81
16 0.81
17 0.76
18 0.69
19 0.63
20 0.58
21 0.57
22 0.55
23 0.54
24 0.52
25 0.54
26 0.56
27 0.56
28 0.54
29 0.49
30 0.46
31 0.48
32 0.43
33 0.41
34 0.43
35 0.46
36 0.42
37 0.39
38 0.4
39 0.37
40 0.39
41 0.37
42 0.32
43 0.35
44 0.34
45 0.35
46 0.34
47 0.31
48 0.28
49 0.28
50 0.36
51 0.32
52 0.41
53 0.45
54 0.44
55 0.45
56 0.46
57 0.45
58 0.39
59 0.35
60 0.28
61 0.26
62 0.24
63 0.26
64 0.22
65 0.19
66 0.18
67 0.18
68 0.18
69 0.2
70 0.22
71 0.21
72 0.22
73 0.22
74 0.2
75 0.18