Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WJZ4

Protein Details
Accession A0A1Y1WJZ4    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-24GFTCKVCKHRQYKTMAKQAYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024158  Mt_import_TIM15  
IPR007853  Znf_DNL-typ  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05180  zf-DNL  
PROSITE View protein in PROSITE  
PS51501  ZF_DNL  
Amino Acid Sequences RMLIGFTCKVCKHRQYKTMAKQAYEKGVVLIQCDSCKNRHLIADNLGWFRDKSVNIEQIMKDKGESVRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.72
4 0.78
5 0.8
6 0.73
7 0.66
8 0.63
9 0.58
10 0.55
11 0.45
12 0.35
13 0.26
14 0.25
15 0.23
16 0.18
17 0.16
18 0.11
19 0.11
20 0.13
21 0.13
22 0.12
23 0.14
24 0.15
25 0.16
26 0.18
27 0.2
28 0.22
29 0.24
30 0.27
31 0.28
32 0.27
33 0.26
34 0.24
35 0.21
36 0.2
37 0.2
38 0.17
39 0.19
40 0.25
41 0.3
42 0.31
43 0.36
44 0.35
45 0.36
46 0.37
47 0.32
48 0.26
49 0.25