Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WM55

Protein Details
Accession A0A1Y1WM55    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MNKSLPSLPQKKQKQKHVFATAIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 9, cyto_nucl 8.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046982  BIN3/RVS161-like  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Gene Ontology GO:0051666  P:actin cortical patch localization  
GO:0006897  P:endocytosis  
Pfam View protein in Pfam  
PF00018  SH3_1  
PROSITE View protein in PROSITE  
PS50002  SH3  
CDD cd00174  SH3  
Amino Acid Sequences MNKSLPSLPQKKQKQKHVFATAIYDYHPQVSGDLRFSAGDRILVKERINDDWWAGEVVTIGEDSVQDGLTGMFPRSHVHVESW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.87
4 0.85
5 0.77
6 0.67
7 0.64
8 0.54
9 0.44
10 0.36
11 0.28
12 0.19
13 0.18
14 0.17
15 0.11
16 0.11
17 0.13
18 0.12
19 0.12
20 0.12
21 0.12
22 0.11
23 0.12
24 0.12
25 0.1
26 0.11
27 0.09
28 0.12
29 0.13
30 0.15
31 0.15
32 0.17
33 0.18
34 0.19
35 0.2
36 0.19
37 0.17
38 0.15
39 0.16
40 0.13
41 0.11
42 0.08
43 0.07
44 0.06
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.04
54 0.05
55 0.05
56 0.07
57 0.08
58 0.09
59 0.09
60 0.1
61 0.12
62 0.16
63 0.19