Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WL09

Protein Details
Accession A0A1Y1WL09    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-74PTLPLRPPRTHWQRRAWRPDQAHydrophilic
97-118AAPPRHRPCRCPPRRPPAHHDABasic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
Amino Acid Sequences MGSATLTPAGDTSPLPSDANGSSDRTDDAREPSPPSDSPIELRLAGSENRGDPTLPLRPPRTHWQRRAWRPDQAAGADLASAPQHCVRLRDQLLHLAAPPRHRPCRCPPRRPPAHHDAVARRRPVAEPWDLWLSELAKRAVEHGPHVHRSTPLHAACLLLAGRRPRLVPPGSSPRQCPHVQPRSPPRHCRERLMASVPAVPPATGCAAAAGTSPPSCPHPYRAQSDQMPVAACSPQTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.18
5 0.18
6 0.21
7 0.2
8 0.19
9 0.18
10 0.19
11 0.2
12 0.18
13 0.2
14 0.2
15 0.23
16 0.24
17 0.26
18 0.29
19 0.29
20 0.32
21 0.3
22 0.31
23 0.3
24 0.28
25 0.28
26 0.26
27 0.26
28 0.22
29 0.22
30 0.19
31 0.18
32 0.17
33 0.17
34 0.16
35 0.15
36 0.16
37 0.17
38 0.16
39 0.14
40 0.18
41 0.23
42 0.24
43 0.29
44 0.33
45 0.35
46 0.4
47 0.5
48 0.57
49 0.6
50 0.65
51 0.69
52 0.75
53 0.82
54 0.87
55 0.81
56 0.78
57 0.72
58 0.67
59 0.6
60 0.5
61 0.41
62 0.31
63 0.26
64 0.18
65 0.14
66 0.1
67 0.07
68 0.06
69 0.06
70 0.07
71 0.1
72 0.11
73 0.14
74 0.15
75 0.24
76 0.25
77 0.27
78 0.27
79 0.3
80 0.3
81 0.27
82 0.27
83 0.23
84 0.23
85 0.23
86 0.29
87 0.3
88 0.38
89 0.39
90 0.43
91 0.49
92 0.59
93 0.65
94 0.69
95 0.72
96 0.75
97 0.84
98 0.84
99 0.81
100 0.78
101 0.75
102 0.68
103 0.62
104 0.6
105 0.59
106 0.58
107 0.5
108 0.42
109 0.37
110 0.34
111 0.32
112 0.28
113 0.22
114 0.17
115 0.2
116 0.22
117 0.2
118 0.2
119 0.18
120 0.15
121 0.14
122 0.17
123 0.14
124 0.13
125 0.13
126 0.15
127 0.17
128 0.16
129 0.17
130 0.2
131 0.24
132 0.27
133 0.29
134 0.27
135 0.27
136 0.28
137 0.29
138 0.3
139 0.26
140 0.24
141 0.23
142 0.22
143 0.19
144 0.19
145 0.16
146 0.09
147 0.12
148 0.13
149 0.14
150 0.15
151 0.17
152 0.17
153 0.23
154 0.25
155 0.24
156 0.29
157 0.38
158 0.43
159 0.45
160 0.47
161 0.43
162 0.46
163 0.45
164 0.45
165 0.45
166 0.49
167 0.51
168 0.57
169 0.65
170 0.71
171 0.78
172 0.8
173 0.76
174 0.77
175 0.76
176 0.74
177 0.72
178 0.69
179 0.67
180 0.62
181 0.58
182 0.49
183 0.5
184 0.42
185 0.36
186 0.29
187 0.23
188 0.17
189 0.16
190 0.16
191 0.11
192 0.11
193 0.09
194 0.09
195 0.09
196 0.1
197 0.09
198 0.09
199 0.1
200 0.1
201 0.11
202 0.16
203 0.21
204 0.24
205 0.29
206 0.37
207 0.43
208 0.5
209 0.54
210 0.57
211 0.56
212 0.59
213 0.56
214 0.48
215 0.43
216 0.36
217 0.33
218 0.26
219 0.22