Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0EZ05

Protein Details
Accession H0EZ05    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTKNSQRKARKKAQTAAKEARGHydrophilic
NLS Segment(s)
PositionSequence
8-12KARKK
Subcellular Location(s) mito 11.5, nucl 8, cyto_mito 8, cyto 3.5, pero 3
Family & Domain DBs
Amino Acid Sequences MTKNSQRKARKKAQTAAKEARGEADQLVPGLFSDEMVKKIMQDSHTVDWDAAGGWHGNDEELLPDPIYPTEKEEWKDPIPEVKRDIIEGWPWEEEPSRAITMQHLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.79
5 0.71
6 0.62
7 0.55
8 0.45
9 0.37
10 0.29
11 0.22
12 0.14
13 0.12
14 0.12
15 0.09
16 0.08
17 0.09
18 0.07
19 0.06
20 0.08
21 0.09
22 0.11
23 0.12
24 0.12
25 0.11
26 0.13
27 0.16
28 0.14
29 0.16
30 0.19
31 0.2
32 0.21
33 0.21
34 0.19
35 0.16
36 0.15
37 0.11
38 0.07
39 0.05
40 0.04
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.09
55 0.09
56 0.11
57 0.15
58 0.18
59 0.2
60 0.23
61 0.28
62 0.28
63 0.3
64 0.28
65 0.33
66 0.33
67 0.36
68 0.36
69 0.35
70 0.34
71 0.33
72 0.33
73 0.27
74 0.27
75 0.25
76 0.24
77 0.21
78 0.21
79 0.21
80 0.21
81 0.19
82 0.17
83 0.19
84 0.18
85 0.17
86 0.17