Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DTB3

Protein Details
Accession A0A1Y2DTB3   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
253-285QIMNYKAPKKIKSNNNRNNKWSNNNNNNNNNSNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR040151  Gfd2/YDR514C-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MNMTNENSDTIDEDPGTKPSVLDIIYDDNIILPANLLNPLDRTYEKPEKIQKRIKLIVTIKEKIDDEKLYICLDIEAFERNHDFLTEFGWCLFKKNGEIIKKKHAIVEEYINYHNGRYVPDNKNNYNFGKSEIVKLKDIYRELKNDFDRANYLVGHGINNDIQFLKKIQVDVSKFKKMNGNSSKIDDYGIIETMDLFSGFFLTKPVGLEKSLRRLEIPYRSLHNAGNDAYYTMQVFLEIIKRFDFSKDPKYEQIMNYKAPKKIKSNNNRNNKWSNNNNNNNNNSNNNNNNGNSMNDSNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.2
4 0.18
5 0.16
6 0.15
7 0.18
8 0.16
9 0.15
10 0.16
11 0.18
12 0.18
13 0.19
14 0.17
15 0.14
16 0.14
17 0.13
18 0.1
19 0.06
20 0.06
21 0.07
22 0.09
23 0.09
24 0.09
25 0.11
26 0.13
27 0.16
28 0.17
29 0.2
30 0.28
31 0.37
32 0.38
33 0.45
34 0.53
35 0.59
36 0.67
37 0.72
38 0.69
39 0.69
40 0.74
41 0.69
42 0.68
43 0.64
44 0.63
45 0.62
46 0.6
47 0.51
48 0.48
49 0.45
50 0.38
51 0.38
52 0.3
53 0.24
54 0.23
55 0.23
56 0.2
57 0.2
58 0.17
59 0.13
60 0.12
61 0.11
62 0.09
63 0.11
64 0.1
65 0.12
66 0.13
67 0.13
68 0.13
69 0.12
70 0.12
71 0.08
72 0.1
73 0.1
74 0.09
75 0.09
76 0.12
77 0.12
78 0.15
79 0.16
80 0.15
81 0.16
82 0.22
83 0.28
84 0.34
85 0.42
86 0.43
87 0.51
88 0.55
89 0.53
90 0.5
91 0.45
92 0.39
93 0.34
94 0.37
95 0.3
96 0.28
97 0.28
98 0.26
99 0.24
100 0.21
101 0.21
102 0.14
103 0.14
104 0.15
105 0.24
106 0.29
107 0.37
108 0.43
109 0.43
110 0.47
111 0.49
112 0.46
113 0.4
114 0.34
115 0.29
116 0.29
117 0.27
118 0.29
119 0.31
120 0.31
121 0.3
122 0.3
123 0.3
124 0.28
125 0.29
126 0.28
127 0.25
128 0.27
129 0.27
130 0.33
131 0.31
132 0.31
133 0.29
134 0.25
135 0.23
136 0.2
137 0.2
138 0.13
139 0.12
140 0.11
141 0.11
142 0.1
143 0.08
144 0.08
145 0.08
146 0.08
147 0.08
148 0.07
149 0.07
150 0.07
151 0.08
152 0.1
153 0.1
154 0.1
155 0.12
156 0.18
157 0.21
158 0.28
159 0.33
160 0.38
161 0.38
162 0.39
163 0.43
164 0.38
165 0.45
166 0.45
167 0.45
168 0.39
169 0.43
170 0.42
171 0.36
172 0.36
173 0.25
174 0.2
175 0.15
176 0.14
177 0.1
178 0.08
179 0.08
180 0.08
181 0.07
182 0.06
183 0.04
184 0.03
185 0.04
186 0.05
187 0.05
188 0.05
189 0.06
190 0.06
191 0.07
192 0.1
193 0.1
194 0.11
195 0.17
196 0.2
197 0.29
198 0.3
199 0.3
200 0.29
201 0.31
202 0.36
203 0.4
204 0.39
205 0.33
206 0.35
207 0.38
208 0.39
209 0.38
210 0.34
211 0.28
212 0.26
213 0.23
214 0.19
215 0.17
216 0.15
217 0.13
218 0.11
219 0.09
220 0.08
221 0.07
222 0.07
223 0.07
224 0.13
225 0.14
226 0.14
227 0.14
228 0.16
229 0.17
230 0.19
231 0.25
232 0.25
233 0.34
234 0.39
235 0.43
236 0.47
237 0.52
238 0.55
239 0.52
240 0.56
241 0.5
242 0.5
243 0.55
244 0.56
245 0.56
246 0.57
247 0.6
248 0.59
249 0.64
250 0.69
251 0.71
252 0.77
253 0.81
254 0.85
255 0.86
256 0.85
257 0.85
258 0.82
259 0.8
260 0.8
261 0.81
262 0.81
263 0.83
264 0.86
265 0.85
266 0.83
267 0.79
268 0.73
269 0.68
270 0.62
271 0.6
272 0.56
273 0.52
274 0.51
275 0.46
276 0.46
277 0.41
278 0.39
279 0.35