Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y8P7

Protein Details
Accession A0A1Y1Y8P7    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
141-163NIKSHVRCLFRYRKKFSRKLFMKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10.833, cyto_mito 6.666, cyto 6.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036156  Beta-gal/glucu_dom_sf  
IPR013783  Ig-like_fold  
Amino Acid Sequences MKKSEPWQSRYDGYVPEPEIPLNYNLISLYRKKFTLDSSIRKSGRRIYMIYDGGIFRDAFLVSAPNVQIRDYTVRTNLDSSFTNANLEISMDIRNLSGGEKNSWSVIAKAYDEAGNNILKGASVKLDKLNIGKDKSVVSTNIKSHVRCLFRYRKKFSRKLFMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.33
4 0.31
5 0.27
6 0.25
7 0.23
8 0.22
9 0.17
10 0.15
11 0.13
12 0.12
13 0.14
14 0.17
15 0.2
16 0.23
17 0.24
18 0.25
19 0.26
20 0.28
21 0.29
22 0.36
23 0.39
24 0.43
25 0.48
26 0.56
27 0.57
28 0.57
29 0.57
30 0.54
31 0.53
32 0.47
33 0.41
34 0.37
35 0.42
36 0.41
37 0.38
38 0.32
39 0.24
40 0.21
41 0.21
42 0.16
43 0.09
44 0.09
45 0.08
46 0.06
47 0.06
48 0.07
49 0.06
50 0.08
51 0.08
52 0.08
53 0.09
54 0.09
55 0.09
56 0.1
57 0.14
58 0.14
59 0.15
60 0.16
61 0.17
62 0.18
63 0.19
64 0.18
65 0.16
66 0.14
67 0.15
68 0.14
69 0.13
70 0.13
71 0.11
72 0.11
73 0.09
74 0.08
75 0.06
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.08
85 0.09
86 0.11
87 0.11
88 0.12
89 0.12
90 0.13
91 0.13
92 0.11
93 0.12
94 0.11
95 0.11
96 0.11
97 0.12
98 0.13
99 0.12
100 0.13
101 0.13
102 0.11
103 0.11
104 0.11
105 0.09
106 0.08
107 0.08
108 0.08
109 0.09
110 0.1
111 0.12
112 0.14
113 0.16
114 0.18
115 0.2
116 0.27
117 0.29
118 0.31
119 0.31
120 0.3
121 0.3
122 0.3
123 0.3
124 0.27
125 0.27
126 0.31
127 0.32
128 0.38
129 0.41
130 0.39
131 0.41
132 0.46
133 0.44
134 0.42
135 0.49
136 0.52
137 0.59
138 0.69
139 0.73
140 0.75
141 0.81
142 0.87
143 0.87