Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CAE6

Protein Details
Accession A0A1Y2CAE6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-54NFSFQRKDKSKIYRRTKYKTSNKCKFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MEDNIEIEISETNRGNEQIIINKKYKFNFSFQRKDKSKIYRRTKYKTSNKCKFLIILNDKKEVLKYESLHNSLEKEIDVSISVAKHKIKEEIRKNSIPMDIKPKHIFNAVSQEMGLICPEYINIDIFNIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.19
5 0.24
6 0.31
7 0.34
8 0.36
9 0.39
10 0.43
11 0.43
12 0.49
13 0.43
14 0.43
15 0.49
16 0.54
17 0.61
18 0.63
19 0.71
20 0.67
21 0.69
22 0.7
23 0.7
24 0.71
25 0.71
26 0.76
27 0.75
28 0.8
29 0.82
30 0.83
31 0.83
32 0.84
33 0.84
34 0.84
35 0.84
36 0.8
37 0.74
38 0.66
39 0.57
40 0.5
41 0.49
42 0.46
43 0.45
44 0.43
45 0.42
46 0.41
47 0.4
48 0.36
49 0.28
50 0.23
51 0.19
52 0.17
53 0.21
54 0.25
55 0.26
56 0.26
57 0.25
58 0.23
59 0.19
60 0.19
61 0.13
62 0.09
63 0.08
64 0.07
65 0.07
66 0.06
67 0.07
68 0.07
69 0.08
70 0.1
71 0.12
72 0.14
73 0.15
74 0.22
75 0.28
76 0.37
77 0.46
78 0.53
79 0.59
80 0.6
81 0.6
82 0.56
83 0.55
84 0.48
85 0.42
86 0.42
87 0.38
88 0.42
89 0.45
90 0.44
91 0.4
92 0.41
93 0.39
94 0.32
95 0.39
96 0.34
97 0.3
98 0.28
99 0.26
100 0.21
101 0.2
102 0.17
103 0.08
104 0.07
105 0.06
106 0.06
107 0.08
108 0.09
109 0.1
110 0.09