Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DM95

Protein Details
Accession A0A1Y2DM95    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-32YNNNKMNSRDDKRKSGRKYNISRNSGNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 10.999, cyto_nucl 10.666, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYDKHYNNNKMNSRDDKRKSGRKYNISRNSGNNMNFNNHHNSNVNHNKFKFNSAEVSNYLTKNWKEVNSMIEDSSIAKEEKPVIYQNPEKAWSKGSTHVWASPKTGVTSSGVDFIAELKKLEIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.72
3 0.73
4 0.75
5 0.8
6 0.8
7 0.81
8 0.82
9 0.82
10 0.86
11 0.86
12 0.87
13 0.83
14 0.79
15 0.73
16 0.68
17 0.65
18 0.57
19 0.51
20 0.43
21 0.41
22 0.38
23 0.37
24 0.38
25 0.32
26 0.32
27 0.29
28 0.28
29 0.34
30 0.42
31 0.44
32 0.43
33 0.44
34 0.47
35 0.45
36 0.47
37 0.39
38 0.31
39 0.29
40 0.25
41 0.26
42 0.22
43 0.25
44 0.23
45 0.21
46 0.2
47 0.2
48 0.19
49 0.19
50 0.2
51 0.17
52 0.18
53 0.19
54 0.2
55 0.2
56 0.21
57 0.18
58 0.16
59 0.15
60 0.13
61 0.13
62 0.12
63 0.08
64 0.08
65 0.09
66 0.11
67 0.12
68 0.13
69 0.15
70 0.16
71 0.23
72 0.27
73 0.29
74 0.3
75 0.33
76 0.33
77 0.32
78 0.33
79 0.29
80 0.28
81 0.31
82 0.32
83 0.33
84 0.33
85 0.37
86 0.38
87 0.37
88 0.37
89 0.34
90 0.31
91 0.28
92 0.27
93 0.23
94 0.21
95 0.22
96 0.2
97 0.2
98 0.18
99 0.16
100 0.15
101 0.16
102 0.17
103 0.15
104 0.14
105 0.13