Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C952

Protein Details
Accession A0A1Y2C952    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
250-272KEAYNKMYKKTLKKRIENDTSGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001464  Annexin  
IPR018502  Annexin_repeat  
IPR018252  Annexin_repeat_CS  
IPR037104  Annexin_sf  
Gene Ontology GO:0005509  F:calcium ion binding  
GO:0005544  F:calcium-dependent phospholipid binding  
Pfam View protein in Pfam  
PF00191  Annexin  
PROSITE View protein in PROSITE  
PS00223  ANNEXIN_1  
PS51897  ANNEXIN_2  
Amino Acid Sequences KKKLIDILSKYPPIQMDQILAEYKAEYKKSLNFDVKSKTSGNFGKLCSALTQTTLDYDVWCLHNAIDRIGTDERCLIDILIGRTNKDIITMCNAYKKTYNKSLEEDIKGDTSGYFRKFLVAIVQGNRDESDNERDVQTDVEALFKAGEGRLGTDETTFITIFTNRSDAHLIKVFDKYQQIYKSSMIKAIKGEFSGDIKNSLLAHVRAIIDYNDYVADLFEKSMKGLGTRNEMLIRLVVRYRDPALMNPIKEAYNKMYKKTLKKRIENDTSGSFRTLLCKCIENCKPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.31
3 0.25
4 0.23
5 0.25
6 0.24
7 0.22
8 0.19
9 0.16
10 0.2
11 0.22
12 0.22
13 0.21
14 0.23
15 0.29
16 0.35
17 0.43
18 0.47
19 0.45
20 0.5
21 0.56
22 0.54
23 0.52
24 0.48
25 0.4
26 0.39
27 0.41
28 0.4
29 0.37
30 0.35
31 0.36
32 0.34
33 0.34
34 0.28
35 0.27
36 0.22
37 0.19
38 0.2
39 0.15
40 0.16
41 0.16
42 0.15
43 0.12
44 0.13
45 0.14
46 0.14
47 0.14
48 0.13
49 0.12
50 0.17
51 0.17
52 0.16
53 0.16
54 0.14
55 0.18
56 0.21
57 0.21
58 0.17
59 0.18
60 0.18
61 0.16
62 0.17
63 0.12
64 0.11
65 0.14
66 0.15
67 0.19
68 0.18
69 0.18
70 0.18
71 0.19
72 0.17
73 0.16
74 0.15
75 0.11
76 0.17
77 0.19
78 0.19
79 0.24
80 0.25
81 0.25
82 0.3
83 0.33
84 0.33
85 0.4
86 0.44
87 0.41
88 0.45
89 0.5
90 0.5
91 0.47
92 0.42
93 0.34
94 0.3
95 0.26
96 0.22
97 0.15
98 0.12
99 0.14
100 0.14
101 0.14
102 0.14
103 0.15
104 0.15
105 0.15
106 0.16
107 0.15
108 0.16
109 0.16
110 0.19
111 0.18
112 0.18
113 0.19
114 0.16
115 0.13
116 0.13
117 0.17
118 0.15
119 0.16
120 0.16
121 0.16
122 0.16
123 0.15
124 0.12
125 0.08
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.05
132 0.06
133 0.05
134 0.06
135 0.05
136 0.06
137 0.07
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.08
144 0.07
145 0.06
146 0.07
147 0.07
148 0.08
149 0.08
150 0.1
151 0.09
152 0.11
153 0.14
154 0.13
155 0.16
156 0.2
157 0.2
158 0.19
159 0.22
160 0.21
161 0.21
162 0.23
163 0.22
164 0.23
165 0.25
166 0.26
167 0.25
168 0.28
169 0.31
170 0.29
171 0.33
172 0.28
173 0.26
174 0.27
175 0.27
176 0.25
177 0.2
178 0.2
179 0.16
180 0.17
181 0.18
182 0.16
183 0.15
184 0.13
185 0.15
186 0.13
187 0.13
188 0.14
189 0.12
190 0.12
191 0.14
192 0.14
193 0.12
194 0.14
195 0.13
196 0.11
197 0.11
198 0.11
199 0.08
200 0.08
201 0.08
202 0.07
203 0.07
204 0.06
205 0.06
206 0.08
207 0.08
208 0.08
209 0.1
210 0.1
211 0.11
212 0.15
213 0.18
214 0.23
215 0.24
216 0.27
217 0.26
218 0.26
219 0.25
220 0.24
221 0.21
222 0.16
223 0.17
224 0.17
225 0.17
226 0.2
227 0.21
228 0.24
229 0.24
230 0.25
231 0.32
232 0.36
233 0.35
234 0.34
235 0.34
236 0.31
237 0.31
238 0.32
239 0.29
240 0.34
241 0.35
242 0.37
243 0.44
244 0.51
245 0.6
246 0.67
247 0.72
248 0.72
249 0.79
250 0.84
251 0.85
252 0.87
253 0.81
254 0.75
255 0.73
256 0.66
257 0.58
258 0.51
259 0.41
260 0.32
261 0.35
262 0.31
263 0.26
264 0.25
265 0.3
266 0.3
267 0.4