Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EUG1

Protein Details
Accession A0A1Y2EUG1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
108-133SAILKSKKPAKTIKKREQKGARKVRAHydrophilic
NLS Segment(s)
PositionSequence
104-133AARVSAILKSKKPAKTIKKREQKGARKVRA
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSADLVWQIVKNNNAYLVKKCGVQFSSEPGNLMNVNSFKYSGIANNKAVIIGSTEKGVSFATTKASNKNLKTTAVELKKGARPSANAVKNVLKGYRPDLSKAAAARVSAILKSKKPAKTIKKREQKGARKVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.33
4 0.35
5 0.33
6 0.35
7 0.35
8 0.35
9 0.31
10 0.33
11 0.3
12 0.29
13 0.35
14 0.32
15 0.31
16 0.25
17 0.26
18 0.22
19 0.21
20 0.19
21 0.12
22 0.14
23 0.14
24 0.14
25 0.12
26 0.13
27 0.13
28 0.15
29 0.2
30 0.23
31 0.23
32 0.24
33 0.23
34 0.23
35 0.22
36 0.16
37 0.12
38 0.1
39 0.09
40 0.09
41 0.09
42 0.08
43 0.09
44 0.09
45 0.07
46 0.06
47 0.07
48 0.08
49 0.11
50 0.12
51 0.15
52 0.21
53 0.25
54 0.25
55 0.3
56 0.29
57 0.28
58 0.29
59 0.29
60 0.32
61 0.29
62 0.3
63 0.26
64 0.28
65 0.3
66 0.3
67 0.29
68 0.22
69 0.2
70 0.26
71 0.34
72 0.35
73 0.32
74 0.34
75 0.35
76 0.36
77 0.37
78 0.32
79 0.24
80 0.21
81 0.24
82 0.27
83 0.25
84 0.25
85 0.26
86 0.26
87 0.28
88 0.27
89 0.26
90 0.22
91 0.2
92 0.19
93 0.19
94 0.19
95 0.17
96 0.22
97 0.23
98 0.24
99 0.31
100 0.37
101 0.4
102 0.46
103 0.55
104 0.6
105 0.67
106 0.76
107 0.8
108 0.83
109 0.85
110 0.89
111 0.89
112 0.89
113 0.88