Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BXZ2

Protein Details
Accession A0A1Y2BXZ2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
59-85GLYVLNKQLKKKKRVKKANPDNVPYKWHydrophilic
NLS Segment(s)
PositionSequence
67-76LKKKKRVKKA
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 11.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006616  DM9_repeat  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF11901  DUF3421  
Amino Acid Sequences MSDEWEYVTDDEGDFIEDENGNILTPEEAEQRGLVTKSDGTTDRSIGAGILAGGALLGGLYVLNKQLKKKKRVKKANPDNVPYKWVKWTGTTPANAVSDKNNIGKTFIIGRGVYENGLHPGYADPATKKLYTSYGGEEVVLKEFEILTCPQNRLTWIKCNDPKNIGAKAVIGGYEKDDTPLYVTKCMRDKTPYFGKTYKNGYCAYYGYDGKEWKLNDFEYLAYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.1
5 0.1
6 0.11
7 0.1
8 0.09
9 0.09
10 0.09
11 0.07
12 0.07
13 0.09
14 0.11
15 0.11
16 0.12
17 0.12
18 0.13
19 0.16
20 0.16
21 0.14
22 0.13
23 0.14
24 0.14
25 0.18
26 0.19
27 0.2
28 0.22
29 0.22
30 0.21
31 0.19
32 0.18
33 0.15
34 0.13
35 0.08
36 0.06
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.02
43 0.02
44 0.02
45 0.01
46 0.02
47 0.02
48 0.03
49 0.06
50 0.1
51 0.12
52 0.19
53 0.29
54 0.38
55 0.48
56 0.59
57 0.65
58 0.73
59 0.82
60 0.87
61 0.89
62 0.92
63 0.92
64 0.89
65 0.86
66 0.8
67 0.7
68 0.64
69 0.54
70 0.44
71 0.37
72 0.32
73 0.27
74 0.24
75 0.26
76 0.27
77 0.3
78 0.29
79 0.26
80 0.26
81 0.27
82 0.24
83 0.22
84 0.17
85 0.15
86 0.17
87 0.18
88 0.17
89 0.15
90 0.16
91 0.16
92 0.15
93 0.15
94 0.14
95 0.13
96 0.11
97 0.12
98 0.12
99 0.12
100 0.11
101 0.09
102 0.08
103 0.08
104 0.08
105 0.08
106 0.07
107 0.07
108 0.08
109 0.09
110 0.09
111 0.08
112 0.11
113 0.14
114 0.14
115 0.14
116 0.13
117 0.14
118 0.15
119 0.16
120 0.17
121 0.16
122 0.16
123 0.16
124 0.15
125 0.14
126 0.13
127 0.11
128 0.09
129 0.07
130 0.07
131 0.06
132 0.08
133 0.09
134 0.1
135 0.13
136 0.14
137 0.16
138 0.16
139 0.19
140 0.22
141 0.25
142 0.31
143 0.32
144 0.41
145 0.46
146 0.49
147 0.51
148 0.49
149 0.5
150 0.47
151 0.45
152 0.37
153 0.31
154 0.27
155 0.23
156 0.2
157 0.17
158 0.12
159 0.1
160 0.11
161 0.12
162 0.12
163 0.12
164 0.12
165 0.11
166 0.13
167 0.18
168 0.18
169 0.23
170 0.25
171 0.29
172 0.35
173 0.37
174 0.38
175 0.4
176 0.41
177 0.43
178 0.52
179 0.5
180 0.5
181 0.54
182 0.55
183 0.54
184 0.61
185 0.57
186 0.51
187 0.49
188 0.45
189 0.42
190 0.38
191 0.35
192 0.32
193 0.29
194 0.28
195 0.31
196 0.31
197 0.3
198 0.35
199 0.31
200 0.29
201 0.32
202 0.29
203 0.27
204 0.26