Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AJB2

Protein Details
Accession A0A1Y2AJB2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
126-156ISPSPQPSRIFRKRNPKNTLKPNKNENPIPIHydrophilic
NLS Segment(s)
PositionSequence
62-64PKA
67-69PKK
Subcellular Location(s) E.R. 6golg 6, mito 4, extr 4, pero 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MEKSYKYSLKHILLIVLIFSLLLVQVSSEPKEKVEPKPEKKIEGQKSNILNNKNSKAVTNKPKALTPKKYRKNFVIRIPKTVFNSDGPKRITITRTTPPVTIGYEIPTHTGDETTTYYSTFGYDFISPSPQPSRIFRKRNPKNTLKPNKNENPIPITKAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.26
3 0.17
4 0.13
5 0.08
6 0.07
7 0.05
8 0.04
9 0.03
10 0.03
11 0.03
12 0.06
13 0.08
14 0.11
15 0.14
16 0.14
17 0.15
18 0.23
19 0.27
20 0.32
21 0.41
22 0.5
23 0.54
24 0.65
25 0.67
26 0.65
27 0.68
28 0.71
29 0.7
30 0.68
31 0.64
32 0.6
33 0.61
34 0.63
35 0.61
36 0.54
37 0.5
38 0.48
39 0.47
40 0.43
41 0.39
42 0.34
43 0.34
44 0.4
45 0.45
46 0.45
47 0.48
48 0.46
49 0.49
50 0.56
51 0.59
52 0.6
53 0.61
54 0.64
55 0.69
56 0.75
57 0.75
58 0.74
59 0.76
60 0.72
61 0.72
62 0.72
63 0.64
64 0.64
65 0.62
66 0.57
67 0.49
68 0.44
69 0.36
70 0.27
71 0.33
72 0.28
73 0.31
74 0.29
75 0.27
76 0.27
77 0.28
78 0.27
79 0.24
80 0.27
81 0.26
82 0.3
83 0.31
84 0.3
85 0.29
86 0.28
87 0.26
88 0.22
89 0.18
90 0.15
91 0.14
92 0.14
93 0.14
94 0.13
95 0.13
96 0.11
97 0.11
98 0.09
99 0.1
100 0.12
101 0.12
102 0.12
103 0.12
104 0.12
105 0.12
106 0.12
107 0.1
108 0.09
109 0.09
110 0.09
111 0.1
112 0.1
113 0.15
114 0.14
115 0.18
116 0.21
117 0.23
118 0.26
119 0.32
120 0.41
121 0.47
122 0.56
123 0.61
124 0.68
125 0.75
126 0.83
127 0.86
128 0.86
129 0.86
130 0.88
131 0.92
132 0.91
133 0.89
134 0.89
135 0.88
136 0.86
137 0.81
138 0.76
139 0.73
140 0.67