Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2F3M9

Protein Details
Accession A0A1Y2F3M9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-22TINNIKFTYKRKDNNTFQSLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028005  AcTrfase_ESCO_Znf_dom  
Pfam View protein in Pfam  
PF13878  zf-C2H2_3  
Amino Acid Sequences MTINNIKFTYKRKDNNTFQSLNNKKIRLLNSTGNEIIKENEISFENVDTYKLKNKKQNHNDISSYFNKKIPKHDKEPIESSDSPMSIMKSKRTIESYFQSKPNKGNENKIKNSEKNIDNKKNDSSIIDKKKMQTKKNYEQLYIDFGQKGISPIICTECGMPYNPSIQEDDLQHQQYHNIIIDGIEYNGYKTDNVVQKFSKNVYISEVEMSETTSSHKNKYQEFLRYVVLVEYGFREKNVKKELHHNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.82
3 0.83
4 0.76
5 0.7
6 0.72
7 0.69
8 0.68
9 0.65
10 0.56
11 0.52
12 0.55
13 0.55
14 0.5
15 0.5
16 0.5
17 0.46
18 0.5
19 0.49
20 0.43
21 0.39
22 0.34
23 0.29
24 0.23
25 0.21
26 0.15
27 0.15
28 0.15
29 0.16
30 0.16
31 0.15
32 0.14
33 0.13
34 0.14
35 0.14
36 0.15
37 0.23
38 0.29
39 0.35
40 0.42
41 0.51
42 0.61
43 0.7
44 0.78
45 0.76
46 0.76
47 0.73
48 0.66
49 0.63
50 0.59
51 0.55
52 0.45
53 0.42
54 0.42
55 0.41
56 0.5
57 0.54
58 0.55
59 0.56
60 0.62
61 0.65
62 0.65
63 0.67
64 0.6
65 0.57
66 0.49
67 0.44
68 0.38
69 0.32
70 0.27
71 0.23
72 0.21
73 0.18
74 0.2
75 0.2
76 0.23
77 0.25
78 0.27
79 0.3
80 0.31
81 0.31
82 0.35
83 0.39
84 0.37
85 0.43
86 0.44
87 0.42
88 0.45
89 0.47
90 0.49
91 0.45
92 0.51
93 0.55
94 0.59
95 0.61
96 0.63
97 0.63
98 0.56
99 0.59
100 0.56
101 0.5
102 0.5
103 0.56
104 0.57
105 0.54
106 0.55
107 0.51
108 0.46
109 0.42
110 0.34
111 0.31
112 0.31
113 0.35
114 0.36
115 0.36
116 0.38
117 0.46
118 0.51
119 0.52
120 0.53
121 0.55
122 0.61
123 0.68
124 0.67
125 0.6
126 0.55
127 0.5
128 0.45
129 0.36
130 0.28
131 0.2
132 0.17
133 0.16
134 0.14
135 0.14
136 0.1
137 0.08
138 0.07
139 0.08
140 0.11
141 0.11
142 0.1
143 0.1
144 0.1
145 0.11
146 0.12
147 0.12
148 0.11
149 0.14
150 0.14
151 0.14
152 0.15
153 0.15
154 0.16
155 0.17
156 0.2
157 0.22
158 0.23
159 0.22
160 0.21
161 0.21
162 0.2
163 0.2
164 0.17
165 0.12
166 0.09
167 0.09
168 0.1
169 0.1
170 0.09
171 0.08
172 0.07
173 0.07
174 0.09
175 0.09
176 0.08
177 0.08
178 0.15
179 0.21
180 0.23
181 0.27
182 0.28
183 0.3
184 0.33
185 0.34
186 0.34
187 0.29
188 0.28
189 0.28
190 0.28
191 0.27
192 0.25
193 0.24
194 0.18
195 0.17
196 0.17
197 0.13
198 0.11
199 0.12
200 0.18
201 0.2
202 0.23
203 0.29
204 0.33
205 0.37
206 0.45
207 0.49
208 0.51
209 0.52
210 0.51
211 0.47
212 0.43
213 0.39
214 0.31
215 0.25
216 0.16
217 0.14
218 0.15
219 0.17
220 0.17
221 0.17
222 0.24
223 0.25
224 0.34
225 0.42
226 0.44
227 0.44