Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DWZ0

Protein Details
Accession A0A1Y2DWZ0   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-40TTFSSIKQKKYFQTKRKYKKTLKINPKTVESHydrophilic
52-71EGKYLKSKKLSKKVNSNKNYHydrophilic
86-107IVKTSKRTKKFNLHNKRNQNLIHydrophilic
NLS Segment(s)
PositionSequence
55-96YLKSKKLSKKVNSNKNYSNSKKFLKLKKLNRIVKTSKRTKKF
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MSTLIKLNYTTFSSIKQKKYFQTKRKYKKTLKINPKTVESNLSNKIKITHNEGKYLKSKKLSKKVNSNKNYSNSKKFLKLKKLNRIVKTSKRTKKFNLHNKRNQNLICTKKSFFKNSQNGHTNYRSHFRKSIKPKYKFISVKKRCIITCLKNLPLYKNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.48
3 0.52
4 0.55
5 0.6
6 0.71
7 0.76
8 0.76
9 0.79
10 0.82
11 0.86
12 0.91
13 0.93
14 0.91
15 0.9
16 0.91
17 0.91
18 0.91
19 0.9
20 0.89
21 0.83
22 0.78
23 0.73
24 0.63
25 0.6
26 0.51
27 0.47
28 0.45
29 0.44
30 0.38
31 0.35
32 0.37
33 0.34
34 0.33
35 0.36
36 0.38
37 0.36
38 0.44
39 0.44
40 0.45
41 0.48
42 0.5
43 0.45
44 0.44
45 0.5
46 0.52
47 0.61
48 0.66
49 0.66
50 0.73
51 0.79
52 0.81
53 0.79
54 0.76
55 0.72
56 0.7
57 0.71
58 0.66
59 0.63
60 0.57
61 0.54
62 0.56
63 0.57
64 0.57
65 0.59
66 0.63
67 0.65
68 0.71
69 0.78
70 0.77
71 0.74
72 0.74
73 0.71
74 0.71
75 0.71
76 0.71
77 0.69
78 0.69
79 0.71
80 0.71
81 0.73
82 0.74
83 0.76
84 0.77
85 0.79
86 0.82
87 0.86
88 0.82
89 0.79
90 0.69
91 0.65
92 0.62
93 0.58
94 0.54
95 0.48
96 0.46
97 0.47
98 0.51
99 0.51
100 0.5
101 0.54
102 0.58
103 0.6
104 0.67
105 0.67
106 0.65
107 0.65
108 0.62
109 0.56
110 0.49
111 0.53
112 0.48
113 0.46
114 0.5
115 0.49
116 0.54
117 0.61
118 0.69
119 0.7
120 0.73
121 0.76
122 0.75
123 0.8
124 0.79
125 0.78
126 0.78
127 0.77
128 0.8
129 0.78
130 0.79
131 0.69
132 0.66
133 0.66
134 0.63
135 0.64
136 0.62
137 0.61
138 0.6
139 0.63