Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZM06

Protein Details
Accession A0A1Y1ZM06   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-32IEYTVEKTKKKKKIEIMGIIKLHydrophilic
NLS Segment(s)
PositionSequence
18-36TKKKKKIEIMGIIKLMKKR
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MEYNNKILNEIEYTVEKTKKKKKIEIMGIIKLMKKRKEYYNILKCYLDGRINVNQEIDEYGNNNNNDNNNNIIIIAKYLIKHRPDINKPNEGNHCTPLLEAYNKENNEVIINHIIKKGTHINEIDPKVLLFSATANRYRNTVNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.34
4 0.4
5 0.49
6 0.55
7 0.62
8 0.67
9 0.72
10 0.76
11 0.82
12 0.83
13 0.81
14 0.76
15 0.71
16 0.64
17 0.57
18 0.52
19 0.48
20 0.43
21 0.42
22 0.42
23 0.47
24 0.54
25 0.6
26 0.66
27 0.69
28 0.69
29 0.66
30 0.61
31 0.52
32 0.45
33 0.39
34 0.31
35 0.22
36 0.21
37 0.24
38 0.26
39 0.26
40 0.24
41 0.2
42 0.18
43 0.18
44 0.14
45 0.09
46 0.08
47 0.09
48 0.14
49 0.15
50 0.15
51 0.15
52 0.16
53 0.17
54 0.17
55 0.16
56 0.11
57 0.11
58 0.11
59 0.09
60 0.08
61 0.07
62 0.06
63 0.06
64 0.06
65 0.09
66 0.14
67 0.15
68 0.18
69 0.23
70 0.31
71 0.38
72 0.47
73 0.5
74 0.54
75 0.54
76 0.57
77 0.59
78 0.55
79 0.49
80 0.41
81 0.37
82 0.28
83 0.27
84 0.22
85 0.19
86 0.16
87 0.15
88 0.18
89 0.24
90 0.24
91 0.25
92 0.24
93 0.22
94 0.22
95 0.21
96 0.19
97 0.2
98 0.21
99 0.21
100 0.23
101 0.23
102 0.21
103 0.25
104 0.3
105 0.25
106 0.3
107 0.3
108 0.34
109 0.41
110 0.44
111 0.41
112 0.33
113 0.3
114 0.25
115 0.24
116 0.18
117 0.1
118 0.11
119 0.16
120 0.2
121 0.26
122 0.28
123 0.29
124 0.31