Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2EZM4

Protein Details
Accession A0A1Y2EZM4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MTRGNQREKAREKNLKKQQQQKKNNKNSVMLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MTRGNQREKAREKNLKKQQQQKKNNKNSVMLKLCVKNKLLLLLKKQLLESRYKFILYLIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.85
4 0.86
5 0.85
6 0.86
7 0.89
8 0.89
9 0.9
10 0.9
11 0.89
12 0.82
13 0.79
14 0.73
15 0.71
16 0.63
17 0.54
18 0.47
19 0.44
20 0.44
21 0.4
22 0.35
23 0.28
24 0.25
25 0.31
26 0.34
27 0.33
28 0.35
29 0.4
30 0.41
31 0.4
32 0.41
33 0.38
34 0.34
35 0.39
36 0.37
37 0.35
38 0.35
39 0.34
40 0.33