Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CMZ3

Protein Details
Accession A0A1Y2CMZ3    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
167-195ISSNIQKYKRNCKKKRYLKERTSEEKKREHydrophilic
260-279IIKQKLPSKEIKKEHQKLMDHydrophilic
NLS Segment(s)
PositionSequence
179-188KKKRYLKERT
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000048  IQ_motif_EF-hand-BS  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF00612  IQ  
PROSITE View protein in PROSITE  
PS50096  IQ  
Amino Acid Sequences MEKLDIEKIITIQKLVRGFITRRRLQKLNTNATKIQSIYRGYVARKSYKVNMDLYNKKKRLDNSLVKHERYLKVKLEELKKLQQLSNSKYFEYKKENEKNAAIKIQSMWRGYYTRKNIEKIKKIKSLSSLYEDKENIDIIDLSYIEGNNTQNLINDKIWLKKKFEIISSNIQKYKRNCKKKRYLKERTSEEKKRELDERLKNAQKIMDSYYENYFHFFQLKKKIYENKNALDILSINSNYRYRDYKMNCKKLDELKPLPIIKQKLPSKEIKKEHQKLMDEVTTPWWKVLKKNYDLNQLDFDYINEVLSNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.27
4 0.28
5 0.31
6 0.39
7 0.47
8 0.49
9 0.55
10 0.61
11 0.63
12 0.62
13 0.68
14 0.7
15 0.71
16 0.71
17 0.7
18 0.65
19 0.62
20 0.6
21 0.51
22 0.44
23 0.39
24 0.34
25 0.3
26 0.32
27 0.34
28 0.32
29 0.38
30 0.4
31 0.41
32 0.42
33 0.44
34 0.46
35 0.49
36 0.51
37 0.49
38 0.51
39 0.53
40 0.6
41 0.63
42 0.67
43 0.63
44 0.62
45 0.62
46 0.58
47 0.59
48 0.6
49 0.61
50 0.59
51 0.67
52 0.72
53 0.67
54 0.68
55 0.65
56 0.6
57 0.54
58 0.52
59 0.47
60 0.43
61 0.47
62 0.51
63 0.5
64 0.51
65 0.52
66 0.54
67 0.51
68 0.51
69 0.47
70 0.46
71 0.47
72 0.46
73 0.5
74 0.45
75 0.41
76 0.44
77 0.44
78 0.44
79 0.45
80 0.44
81 0.45
82 0.53
83 0.57
84 0.56
85 0.58
86 0.57
87 0.52
88 0.5
89 0.4
90 0.32
91 0.29
92 0.29
93 0.29
94 0.26
95 0.23
96 0.21
97 0.23
98 0.26
99 0.32
100 0.34
101 0.39
102 0.42
103 0.46
104 0.53
105 0.6
106 0.66
107 0.66
108 0.67
109 0.65
110 0.63
111 0.61
112 0.58
113 0.53
114 0.46
115 0.44
116 0.39
117 0.33
118 0.35
119 0.33
120 0.27
121 0.23
122 0.2
123 0.14
124 0.11
125 0.1
126 0.06
127 0.07
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.06
135 0.06
136 0.07
137 0.07
138 0.08
139 0.1
140 0.13
141 0.11
142 0.13
143 0.14
144 0.2
145 0.27
146 0.28
147 0.3
148 0.31
149 0.36
150 0.36
151 0.38
152 0.36
153 0.33
154 0.4
155 0.43
156 0.44
157 0.42
158 0.42
159 0.43
160 0.45
161 0.52
162 0.53
163 0.58
164 0.63
165 0.69
166 0.79
167 0.85
168 0.9
169 0.9
170 0.91
171 0.88
172 0.89
173 0.87
174 0.86
175 0.85
176 0.82
177 0.76
178 0.73
179 0.66
180 0.6
181 0.55
182 0.52
183 0.52
184 0.52
185 0.55
186 0.55
187 0.58
188 0.55
189 0.52
190 0.48
191 0.39
192 0.33
193 0.29
194 0.24
195 0.21
196 0.23
197 0.24
198 0.24
199 0.23
200 0.23
201 0.22
202 0.18
203 0.21
204 0.2
205 0.22
206 0.31
207 0.36
208 0.36
209 0.42
210 0.51
211 0.53
212 0.62
213 0.63
214 0.56
215 0.55
216 0.53
217 0.46
218 0.37
219 0.32
220 0.23
221 0.2
222 0.17
223 0.13
224 0.16
225 0.18
226 0.18
227 0.21
228 0.24
229 0.23
230 0.32
231 0.38
232 0.46
233 0.55
234 0.64
235 0.63
236 0.63
237 0.68
238 0.67
239 0.7
240 0.69
241 0.63
242 0.59
243 0.64
244 0.61
245 0.58
246 0.56
247 0.51
248 0.46
249 0.51
250 0.5
251 0.5
252 0.54
253 0.61
254 0.63
255 0.68
256 0.71
257 0.72
258 0.77
259 0.78
260 0.81
261 0.8
262 0.75
263 0.68
264 0.67
265 0.61
266 0.51
267 0.44
268 0.43
269 0.39
270 0.35
271 0.34
272 0.31
273 0.29
274 0.35
275 0.44
276 0.46
277 0.49
278 0.58
279 0.63
280 0.7
281 0.71
282 0.68
283 0.63
284 0.55
285 0.49
286 0.4
287 0.33
288 0.26
289 0.22
290 0.19