Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2F1V7

Protein Details
Accession A0A1Y2F1V7    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-95GSKLTFKPKIPARRKQIKIEEEDKPKKSGKERKGKKGFKDRERKSRGRPTYEPBasic
NLS Segment(s)
PositionSequence
43-90GSKLTFKPKIPARRKQIKIEEEDKPKKSGKERKGKKGFKDRERKSRGR
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007811  RPC4  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0003677  F:DNA binding  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF05132  RNA_pol_Rpc4  
Amino Acid Sequences MDSGSTSKSEEKPKVKKTASNSNIRTFGTIGSTETGKIGSLKGSKLTFKPKIPARRKQIKIEEEDKPKKSGKERKGKKGFKDRERKSRGRPTYEPSALSGPFAQGAARPGVKKEYGSGRSYSGISSASGSGIRVEEETTDETKPKIENLKFRDIDDENGEEYYEEDEDVIRPISLIDLTQELNEKMEKIKIEEKNFTFKKIKFEDEFENNLNKVKKENEDRMETEDSTVTTTENEGETYNYPASDLLRNDIKPENNILFFQFPSVLPEIITNNMETDSKFDSSKVKIETADGKISKVDLDTNSSAPEGKFGKLIIYKSGKMKIKMGDILFDVNPGTDCNFYQNAFSFNTDKKEGYILGDIRKRYICTPDIESLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.76
4 0.74
5 0.76
6 0.74
7 0.75
8 0.72
9 0.69
10 0.68
11 0.62
12 0.56
13 0.46
14 0.39
15 0.31
16 0.26
17 0.2
18 0.18
19 0.18
20 0.16
21 0.16
22 0.15
23 0.12
24 0.12
25 0.11
26 0.15
27 0.17
28 0.19
29 0.23
30 0.26
31 0.31
32 0.36
33 0.45
34 0.46
35 0.47
36 0.55
37 0.58
38 0.67
39 0.71
40 0.76
41 0.76
42 0.8
43 0.82
44 0.83
45 0.84
46 0.81
47 0.8
48 0.76
49 0.75
50 0.75
51 0.77
52 0.7
53 0.65
54 0.61
55 0.6
56 0.63
57 0.65
58 0.64
59 0.67
60 0.74
61 0.8
62 0.86
63 0.88
64 0.88
65 0.89
66 0.89
67 0.88
68 0.89
69 0.87
70 0.87
71 0.89
72 0.86
73 0.85
74 0.86
75 0.84
76 0.82
77 0.78
78 0.73
79 0.74
80 0.69
81 0.6
82 0.51
83 0.46
84 0.38
85 0.33
86 0.27
87 0.17
88 0.14
89 0.13
90 0.11
91 0.08
92 0.1
93 0.12
94 0.14
95 0.14
96 0.15
97 0.19
98 0.2
99 0.19
100 0.21
101 0.27
102 0.3
103 0.32
104 0.32
105 0.3
106 0.31
107 0.31
108 0.26
109 0.18
110 0.14
111 0.12
112 0.12
113 0.1
114 0.09
115 0.09
116 0.09
117 0.08
118 0.08
119 0.08
120 0.07
121 0.07
122 0.07
123 0.08
124 0.11
125 0.12
126 0.13
127 0.13
128 0.13
129 0.15
130 0.15
131 0.16
132 0.22
133 0.24
134 0.32
135 0.37
136 0.47
137 0.46
138 0.46
139 0.48
140 0.4
141 0.38
142 0.33
143 0.28
144 0.19
145 0.18
146 0.17
147 0.11
148 0.11
149 0.1
150 0.07
151 0.05
152 0.05
153 0.05
154 0.05
155 0.06
156 0.06
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.04
163 0.04
164 0.05
165 0.06
166 0.06
167 0.08
168 0.07
169 0.08
170 0.08
171 0.08
172 0.08
173 0.1
174 0.1
175 0.11
176 0.19
177 0.24
178 0.27
179 0.33
180 0.33
181 0.41
182 0.41
183 0.44
184 0.42
185 0.39
186 0.44
187 0.41
188 0.44
189 0.36
190 0.4
191 0.4
192 0.39
193 0.4
194 0.34
195 0.33
196 0.29
197 0.31
198 0.29
199 0.23
200 0.21
201 0.21
202 0.25
203 0.3
204 0.38
205 0.39
206 0.42
207 0.43
208 0.46
209 0.46
210 0.39
211 0.33
212 0.25
213 0.21
214 0.17
215 0.15
216 0.1
217 0.07
218 0.08
219 0.08
220 0.07
221 0.08
222 0.07
223 0.08
224 0.09
225 0.12
226 0.11
227 0.1
228 0.1
229 0.1
230 0.12
231 0.14
232 0.14
233 0.14
234 0.18
235 0.19
236 0.22
237 0.26
238 0.25
239 0.23
240 0.27
241 0.26
242 0.23
243 0.23
244 0.22
245 0.19
246 0.18
247 0.17
248 0.14
249 0.11
250 0.14
251 0.15
252 0.13
253 0.12
254 0.13
255 0.14
256 0.15
257 0.15
258 0.12
259 0.1
260 0.11
261 0.12
262 0.1
263 0.12
264 0.13
265 0.14
266 0.15
267 0.15
268 0.19
269 0.21
270 0.27
271 0.26
272 0.25
273 0.24
274 0.27
275 0.33
276 0.32
277 0.38
278 0.32
279 0.3
280 0.29
281 0.29
282 0.26
283 0.2
284 0.2
285 0.13
286 0.19
287 0.2
288 0.21
289 0.21
290 0.21
291 0.22
292 0.18
293 0.22
294 0.18
295 0.16
296 0.17
297 0.16
298 0.21
299 0.23
300 0.25
301 0.28
302 0.31
303 0.34
304 0.38
305 0.47
306 0.47
307 0.46
308 0.5
309 0.46
310 0.47
311 0.5
312 0.45
313 0.39
314 0.35
315 0.36
316 0.3
317 0.26
318 0.2
319 0.15
320 0.14
321 0.12
322 0.13
323 0.11
324 0.11
325 0.15
326 0.17
327 0.17
328 0.2
329 0.21
330 0.22
331 0.23
332 0.26
333 0.26
334 0.27
335 0.33
336 0.32
337 0.31
338 0.3
339 0.31
340 0.28
341 0.27
342 0.31
343 0.3
344 0.35
345 0.4
346 0.4
347 0.41
348 0.44
349 0.43
350 0.39
351 0.42
352 0.38
353 0.38
354 0.43
355 0.43