Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DCQ5

Protein Details
Accession A0A1Y2DCQ5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-99GCCARSGTKKQKKREIHITSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, plas 5, extr 3, pero 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDTKLFLCALLYSLFSVVNSLAIEYGNVDINTIDSNVKYSKKISYSTKNKGMSNIIKWILIAVIIIVIIAIVVCICCCLGCCARSGTKKQKKREIHITSPEVTPIPYGSSDNYYKEPTQPSPAYNPGYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.08
5 0.08
6 0.08
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.08
13 0.09
14 0.08
15 0.09
16 0.08
17 0.09
18 0.09
19 0.09
20 0.09
21 0.06
22 0.09
23 0.12
24 0.14
25 0.15
26 0.16
27 0.2
28 0.23
29 0.28
30 0.33
31 0.4
32 0.48
33 0.55
34 0.62
35 0.61
36 0.59
37 0.56
38 0.55
39 0.49
40 0.42
41 0.4
42 0.32
43 0.27
44 0.26
45 0.24
46 0.17
47 0.12
48 0.09
49 0.03
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.01
56 0.01
57 0.01
58 0.01
59 0.01
60 0.01
61 0.02
62 0.02
63 0.02
64 0.03
65 0.06
66 0.09
67 0.09
68 0.11
69 0.14
70 0.2
71 0.26
72 0.34
73 0.42
74 0.51
75 0.58
76 0.66
77 0.73
78 0.76
79 0.79
80 0.82
81 0.79
82 0.78
83 0.79
84 0.75
85 0.67
86 0.59
87 0.52
88 0.41
89 0.32
90 0.24
91 0.15
92 0.13
93 0.11
94 0.12
95 0.12
96 0.17
97 0.2
98 0.23
99 0.25
100 0.28
101 0.28
102 0.32
103 0.36
104 0.34
105 0.4
106 0.4
107 0.41
108 0.43
109 0.49