Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FR35

Protein Details
Accession A0A1Y2FR35   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-55FGVCDKTSTKKKKSTTKKSTTKKTTTKKRTTTVHydrophilic
NLS Segment(s)
PositionSequence
32-50KKKKSTTKKSTTKKTTTKK
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001002  Chitin-bd_1  
IPR018371  Chitin-binding_1_CS  
IPR036861  Endochitinase-like_sf  
Gene Ontology GO:0008061  F:chitin binding  
Pfam View protein in Pfam  
PF00187  Chitin_bind_1  
PROSITE View protein in PROSITE  
PS00026  CHIT_BIND_I_1  
PS50941  CHIT_BIND_I_2  
Amino Acid Sequences CCSKYGYCGKTSDYCGRGCQSEFGVCDKTSTKKKKSTTKKSTTKKTTTKKRTTTVSKKVPTSTVSDRCGSNFGACAKSGYCCSKYGYCGKSSDYCGHGCQPRYGLCYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.41
4 0.39
5 0.35
6 0.31
7 0.25
8 0.26
9 0.25
10 0.25
11 0.26
12 0.23
13 0.24
14 0.24
15 0.28
16 0.34
17 0.42
18 0.46
19 0.5
20 0.59
21 0.67
22 0.76
23 0.81
24 0.82
25 0.83
26 0.86
27 0.88
28 0.9
29 0.89
30 0.87
31 0.85
32 0.85
33 0.85
34 0.85
35 0.85
36 0.81
37 0.77
38 0.76
39 0.76
40 0.76
41 0.74
42 0.73
43 0.67
44 0.63
45 0.59
46 0.53
47 0.45
48 0.41
49 0.39
50 0.36
51 0.35
52 0.34
53 0.33
54 0.31
55 0.32
56 0.26
57 0.19
58 0.16
59 0.15
60 0.15
61 0.15
62 0.15
63 0.14
64 0.15
65 0.18
66 0.2
67 0.2
68 0.2
69 0.24
70 0.25
71 0.3
72 0.37
73 0.36
74 0.34
75 0.35
76 0.37
77 0.38
78 0.4
79 0.4
80 0.35
81 0.34
82 0.34
83 0.39
84 0.42
85 0.39
86 0.38
87 0.38
88 0.39