Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FHN3

Protein Details
Accession A0A1Y2FHN3    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21KKKERKIKRPTRVEPKVHMANBasic
NLS Segment(s)
PositionSequence
2-12KKERKIKRPTR
Subcellular Location(s) plas 17, mito 6, nucl 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR003807  DUF202  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF02656  DUF202  
Amino Acid Sequences KKKERKIKRPTRVEPKVHMANERIFLQYMNIGILLAGCSLSLIMYGVSKTSYKLFQHSMFQFIGITSVIYTFVGLLFMIYSLSVYHKRAMKITRNPNRDPLDNTKGIYIIFALVLLAIILNLIMLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.8
4 0.71
5 0.65
6 0.57
7 0.51
8 0.47
9 0.42
10 0.34
11 0.26
12 0.24
13 0.2
14 0.18
15 0.14
16 0.11
17 0.09
18 0.07
19 0.07
20 0.07
21 0.06
22 0.04
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.06
36 0.07
37 0.08
38 0.13
39 0.13
40 0.17
41 0.2
42 0.21
43 0.27
44 0.27
45 0.28
46 0.24
47 0.23
48 0.2
49 0.16
50 0.15
51 0.08
52 0.08
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.06
70 0.09
71 0.11
72 0.15
73 0.19
74 0.2
75 0.25
76 0.32
77 0.39
78 0.46
79 0.56
80 0.62
81 0.65
82 0.67
83 0.71
84 0.69
85 0.63
86 0.6
87 0.58
88 0.56
89 0.51
90 0.49
91 0.41
92 0.36
93 0.32
94 0.26
95 0.17
96 0.1
97 0.08
98 0.07
99 0.06
100 0.05
101 0.05
102 0.04
103 0.04
104 0.03
105 0.02
106 0.02