Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ADR1

Protein Details
Accession A0A1Y2ADR1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
273-293DKKVTSSKKVNNSKNSKVSKKHydrophilic
NLS Segment(s)
PositionSequence
224-240TKAKASASKKNTITKKT
243-245SKK
250-251KK
255-257SKK
262-263KK
268-269KK
274-296KKVTSSKKVNNSKNSKVSKKVTK
Subcellular Location(s) extr 8, E.R. 6, golg 4, pero 3, mito 2, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001002  Chitin-bd_1  
IPR018371  Chitin-binding_1_CS  
IPR036861  Endochitinase-like_sf  
Gene Ontology GO:0008061  F:chitin binding  
Pfam View protein in Pfam  
PF00187  Chitin_bind_1  
PROSITE View protein in PROSITE  
PS00026  CHIT_BIND_I_1  
PS50941  CHIT_BIND_I_2  
PS51257  PROKAR_LIPOPROTEIN  
CDD cd11618  ChtBD1_1  
Amino Acid Sequences MRLFTRILSLISISVALSCHIKYPDECKEEMNEYYDCKYGDSDFYFSEKCQNYFEKHFDLLPKCKSVLTPEEISCETSNHLASYGSTILSVEGVDEDGKECLIVSALNEEYDEKEDYEKKILVAAKNTCGSKKCVNAAIKGFSKKYEAKKKDWEIETDEFYEELLKILKSCDATESKDTTPKKNDSEVKKTKTEKSEKTTITKKADNKKVTTIKNNNNKKNTTTKAKASASKKNTITKKTTTSKKVNVDKKVTSSKKVNNTKKTTTSKKVNVDKKVTSSKKVNNSKNSKVSKKVTKTTGKAKSASNVKISTKGMCGKKYGKCPNGQCCSKYGYCGKTSAYCGAGCQSEFGKCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.1
5 0.1
6 0.14
7 0.15
8 0.18
9 0.2
10 0.28
11 0.36
12 0.39
13 0.39
14 0.37
15 0.4
16 0.42
17 0.41
18 0.37
19 0.29
20 0.28
21 0.29
22 0.3
23 0.25
24 0.21
25 0.21
26 0.19
27 0.23
28 0.23
29 0.23
30 0.22
31 0.25
32 0.25
33 0.24
34 0.31
35 0.29
36 0.28
37 0.3
38 0.34
39 0.36
40 0.41
41 0.46
42 0.41
43 0.4
44 0.41
45 0.44
46 0.46
47 0.47
48 0.45
49 0.43
50 0.4
51 0.39
52 0.37
53 0.36
54 0.35
55 0.34
56 0.34
57 0.32
58 0.35
59 0.35
60 0.37
61 0.31
62 0.25
63 0.21
64 0.18
65 0.18
66 0.14
67 0.14
68 0.11
69 0.11
70 0.13
71 0.12
72 0.1
73 0.09
74 0.09
75 0.09
76 0.08
77 0.08
78 0.05
79 0.04
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.04
92 0.07
93 0.08
94 0.08
95 0.08
96 0.09
97 0.1
98 0.12
99 0.13
100 0.1
101 0.13
102 0.16
103 0.17
104 0.2
105 0.2
106 0.17
107 0.21
108 0.24
109 0.23
110 0.27
111 0.27
112 0.28
113 0.31
114 0.32
115 0.3
116 0.28
117 0.31
118 0.29
119 0.31
120 0.3
121 0.34
122 0.35
123 0.38
124 0.39
125 0.4
126 0.39
127 0.38
128 0.36
129 0.29
130 0.32
131 0.34
132 0.4
133 0.45
134 0.46
135 0.49
136 0.58
137 0.63
138 0.66
139 0.62
140 0.55
141 0.51
142 0.48
143 0.44
144 0.35
145 0.3
146 0.21
147 0.19
148 0.17
149 0.1
150 0.08
151 0.07
152 0.06
153 0.06
154 0.06
155 0.08
156 0.08
157 0.08
158 0.11
159 0.12
160 0.15
161 0.18
162 0.21
163 0.2
164 0.26
165 0.28
166 0.29
167 0.33
168 0.35
169 0.34
170 0.38
171 0.44
172 0.45
173 0.54
174 0.58
175 0.57
176 0.6
177 0.61
178 0.6
179 0.62
180 0.63
181 0.6
182 0.58
183 0.62
184 0.57
185 0.59
186 0.6
187 0.58
188 0.55
189 0.54
190 0.55
191 0.56
192 0.62
193 0.61
194 0.57
195 0.59
196 0.61
197 0.61
198 0.63
199 0.63
200 0.63
201 0.69
202 0.76
203 0.75
204 0.73
205 0.71
206 0.65
207 0.64
208 0.61
209 0.6
210 0.56
211 0.53
212 0.55
213 0.57
214 0.6
215 0.57
216 0.6
217 0.56
218 0.59
219 0.59
220 0.59
221 0.61
222 0.6
223 0.6
224 0.55
225 0.59
226 0.6
227 0.64
228 0.64
229 0.66
230 0.67
231 0.71
232 0.75
233 0.75
234 0.74
235 0.72
236 0.66
237 0.65
238 0.67
239 0.61
240 0.58
241 0.58
242 0.58
243 0.62
244 0.69
245 0.72
246 0.72
247 0.76
248 0.76
249 0.77
250 0.79
251 0.78
252 0.76
253 0.76
254 0.74
255 0.76
256 0.79
257 0.78
258 0.77
259 0.74
260 0.68
261 0.65
262 0.67
263 0.61
264 0.58
265 0.58
266 0.58
267 0.62
268 0.69
269 0.71
270 0.71
271 0.76
272 0.79
273 0.81
274 0.82
275 0.78
276 0.76
277 0.77
278 0.77
279 0.76
280 0.75
281 0.75
282 0.76
283 0.76
284 0.77
285 0.78
286 0.73
287 0.68
288 0.63
289 0.62
290 0.61
291 0.59
292 0.55
293 0.5
294 0.47
295 0.5
296 0.49
297 0.43
298 0.4
299 0.44
300 0.43
301 0.4
302 0.45
303 0.47
304 0.53
305 0.61
306 0.66
307 0.65
308 0.68
309 0.74
310 0.78
311 0.79
312 0.78
313 0.7
314 0.62
315 0.63
316 0.55
317 0.53
318 0.51
319 0.46
320 0.43
321 0.44
322 0.44
323 0.42
324 0.45
325 0.42
326 0.37
327 0.31
328 0.3
329 0.3
330 0.3
331 0.24
332 0.23
333 0.2