Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DDI8

Protein Details
Accession A0A1Y2DDI8   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
91-113DDPRKTNKWANRKNKAKDKKEIEBasic
NLS Segment(s)
PositionSequence
98-110KWANRKNKAKDKK
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MVKKQRKCSLSETYFGYVDTLLDSLVLFNAVINNKLPTIQKRLSRVERRSIISGSVFVFKEDEAGIKRWTDGRYWSPSRILGDYLVYIELDDPRKTNKWANRKNKAKDKKEIEDPVLKNEELQMKKIKYKGIIPSLDLKKFNIRQNGLIKKTLSAKVEGKVFHLISYYHEQDVSYHTINTPSSDEELMKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.34
4 0.23
5 0.19
6 0.15
7 0.1
8 0.07
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.04
15 0.04
16 0.09
17 0.09
18 0.11
19 0.11
20 0.13
21 0.12
22 0.16
23 0.19
24 0.2
25 0.28
26 0.32
27 0.37
28 0.42
29 0.51
30 0.59
31 0.65
32 0.66
33 0.67
34 0.67
35 0.66
36 0.62
37 0.54
38 0.46
39 0.37
40 0.33
41 0.25
42 0.23
43 0.19
44 0.16
45 0.15
46 0.13
47 0.13
48 0.12
49 0.12
50 0.11
51 0.13
52 0.14
53 0.13
54 0.14
55 0.17
56 0.18
57 0.17
58 0.19
59 0.22
60 0.29
61 0.32
62 0.33
63 0.31
64 0.32
65 0.33
66 0.29
67 0.24
68 0.17
69 0.14
70 0.13
71 0.11
72 0.09
73 0.07
74 0.06
75 0.06
76 0.07
77 0.09
78 0.09
79 0.09
80 0.12
81 0.14
82 0.16
83 0.22
84 0.27
85 0.36
86 0.46
87 0.56
88 0.64
89 0.72
90 0.78
91 0.83
92 0.86
93 0.82
94 0.81
95 0.79
96 0.74
97 0.73
98 0.68
99 0.62
100 0.6
101 0.54
102 0.49
103 0.44
104 0.38
105 0.3
106 0.29
107 0.32
108 0.24
109 0.27
110 0.29
111 0.28
112 0.33
113 0.35
114 0.35
115 0.3
116 0.35
117 0.4
118 0.41
119 0.4
120 0.38
121 0.44
122 0.47
123 0.48
124 0.43
125 0.38
126 0.39
127 0.43
128 0.47
129 0.47
130 0.44
131 0.46
132 0.55
133 0.62
134 0.57
135 0.55
136 0.5
137 0.44
138 0.48
139 0.46
140 0.38
141 0.34
142 0.34
143 0.34
144 0.38
145 0.35
146 0.32
147 0.33
148 0.31
149 0.26
150 0.24
151 0.21
152 0.21
153 0.28
154 0.28
155 0.23
156 0.23
157 0.23
158 0.22
159 0.26
160 0.27
161 0.21
162 0.2
163 0.2
164 0.23
165 0.23
166 0.25
167 0.22
168 0.19
169 0.2
170 0.21