Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ASF2

Protein Details
Accession A0A1Y2ASF2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
234-264IIEKNKKSNYKQNFNKKKKFLYNKNNYNKLFHydrophilic
330-358DNNKNFYWTKNIKHRNCNKNNNVNENNNYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MDICVLLRSLLLLKNYGKDVDLWIYDFEEVMDLWDIQNPKRRFVFMKECVDYALKEVLKCIEENGGNKTYPSIQIIKEEIEKYLGITQNNKIWELKEMKIKTNESIPIFNINYIRKYKNIDEEMRKLITVEDYINSIKPRIYPCLKVLEQECENIEEAIKITEKASRIEKKLNFKIDFNNYKQNYKNNYINNHNNNINKENNKIMCFKCYELGHKAFNCKYSFKELSIMEEKGIIEKNKKSNYKQNFNKKKKFLYNKNNYNKLFGKNSNNYYNNNGNYSDYVGNWKNKQNNININKQNNLNNYMSNNNNNNNYQNNKLNTPRYKFNNNYDNNKNFYWTKNIKHRNCNKNNNVNENNNYNIIRNTFKNLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.27
4 0.24
5 0.22
6 0.24
7 0.24
8 0.23
9 0.21
10 0.2
11 0.2
12 0.19
13 0.18
14 0.14
15 0.11
16 0.09
17 0.09
18 0.1
19 0.09
20 0.09
21 0.13
22 0.15
23 0.18
24 0.29
25 0.28
26 0.33
27 0.36
28 0.4
29 0.4
30 0.47
31 0.54
32 0.53
33 0.61
34 0.57
35 0.54
36 0.53
37 0.5
38 0.41
39 0.33
40 0.32
41 0.23
42 0.21
43 0.22
44 0.23
45 0.23
46 0.22
47 0.21
48 0.19
49 0.21
50 0.23
51 0.27
52 0.27
53 0.26
54 0.26
55 0.27
56 0.23
57 0.22
58 0.24
59 0.22
60 0.2
61 0.24
62 0.26
63 0.27
64 0.29
65 0.28
66 0.24
67 0.22
68 0.21
69 0.18
70 0.22
71 0.23
72 0.2
73 0.23
74 0.25
75 0.27
76 0.29
77 0.29
78 0.24
79 0.22
80 0.27
81 0.28
82 0.29
83 0.34
84 0.35
85 0.4
86 0.45
87 0.46
88 0.41
89 0.41
90 0.43
91 0.36
92 0.36
93 0.31
94 0.31
95 0.29
96 0.29
97 0.28
98 0.25
99 0.27
100 0.3
101 0.31
102 0.27
103 0.32
104 0.34
105 0.38
106 0.43
107 0.46
108 0.48
109 0.51
110 0.53
111 0.48
112 0.44
113 0.35
114 0.29
115 0.22
116 0.17
117 0.13
118 0.09
119 0.11
120 0.12
121 0.13
122 0.13
123 0.13
124 0.12
125 0.15
126 0.17
127 0.22
128 0.25
129 0.26
130 0.28
131 0.35
132 0.35
133 0.35
134 0.34
135 0.32
136 0.3
137 0.28
138 0.26
139 0.19
140 0.19
141 0.16
142 0.15
143 0.09
144 0.08
145 0.08
146 0.08
147 0.07
148 0.07
149 0.09
150 0.1
151 0.13
152 0.2
153 0.24
154 0.27
155 0.34
156 0.39
157 0.45
158 0.51
159 0.57
160 0.51
161 0.47
162 0.5
163 0.51
164 0.52
165 0.46
166 0.5
167 0.43
168 0.46
169 0.47
170 0.47
171 0.44
172 0.43
173 0.46
174 0.42
175 0.45
176 0.48
177 0.54
178 0.52
179 0.5
180 0.49
181 0.46
182 0.44
183 0.43
184 0.4
185 0.33
186 0.31
187 0.32
188 0.31
189 0.3
190 0.32
191 0.29
192 0.28
193 0.28
194 0.26
195 0.25
196 0.25
197 0.26
198 0.27
199 0.3
200 0.31
201 0.31
202 0.36
203 0.32
204 0.36
205 0.34
206 0.29
207 0.29
208 0.32
209 0.33
210 0.28
211 0.32
212 0.27
213 0.31
214 0.33
215 0.31
216 0.23
217 0.22
218 0.21
219 0.18
220 0.21
221 0.17
222 0.18
223 0.23
224 0.31
225 0.37
226 0.43
227 0.47
228 0.53
229 0.61
230 0.67
231 0.72
232 0.75
233 0.79
234 0.83
235 0.88
236 0.85
237 0.84
238 0.84
239 0.85
240 0.84
241 0.84
242 0.85
243 0.86
244 0.89
245 0.89
246 0.8
247 0.75
248 0.69
249 0.63
250 0.58
251 0.54
252 0.53
253 0.51
254 0.56
255 0.59
256 0.58
257 0.55
258 0.54
259 0.55
260 0.47
261 0.42
262 0.38
263 0.3
264 0.28
265 0.29
266 0.24
267 0.17
268 0.22
269 0.25
270 0.29
271 0.32
272 0.38
273 0.41
274 0.46
275 0.51
276 0.53
277 0.58
278 0.59
279 0.65
280 0.67
281 0.64
282 0.63
283 0.62
284 0.6
285 0.53
286 0.53
287 0.44
288 0.39
289 0.37
290 0.38
291 0.38
292 0.39
293 0.4
294 0.4
295 0.43
296 0.43
297 0.44
298 0.45
299 0.45
300 0.43
301 0.46
302 0.44
303 0.45
304 0.5
305 0.56
306 0.59
307 0.6
308 0.63
309 0.62
310 0.69
311 0.69
312 0.72
313 0.72
314 0.71
315 0.73
316 0.74
317 0.72
318 0.67
319 0.61
320 0.57
321 0.5
322 0.46
323 0.47
324 0.45
325 0.49
326 0.55
327 0.65
328 0.69
329 0.77
330 0.84
331 0.85
332 0.89
333 0.91
334 0.9
335 0.9
336 0.9
337 0.89
338 0.87
339 0.83
340 0.79
341 0.72
342 0.65
343 0.59
344 0.52
345 0.43
346 0.39
347 0.34
348 0.34
349 0.31
350 0.35