Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AQE7

Protein Details
Accession A0A1Y2AQE7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKAKRKQVVRKRPVLDTQBasic
NLS Segment(s)
PositionSequence
3-15KRKAKRKQVVRKR
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAKRKQVVRKRPVLDTQFNCLFCNHEKSISVKMIHETKVGELKCRICGANYQSPINSLSHPIDVYSDWIDACEELNPGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.79
4 0.75
5 0.73
6 0.65
7 0.62
8 0.58
9 0.55
10 0.49
11 0.4
12 0.36
13 0.29
14 0.32
15 0.26
16 0.22
17 0.22
18 0.24
19 0.29
20 0.29
21 0.27
22 0.21
23 0.23
24 0.25
25 0.25
26 0.23
27 0.18
28 0.16
29 0.2
30 0.2
31 0.19
32 0.19
33 0.19
34 0.2
35 0.21
36 0.2
37 0.15
38 0.21
39 0.25
40 0.3
41 0.31
42 0.3
43 0.28
44 0.3
45 0.31
46 0.27
47 0.21
48 0.17
49 0.16
50 0.16
51 0.16
52 0.15
53 0.15
54 0.14
55 0.16
56 0.14
57 0.13
58 0.11
59 0.12
60 0.12
61 0.11
62 0.11
63 0.09
64 0.09