Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CFR5

Protein Details
Accession A0A1Y2CFR5   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-80LSLGEKPKREHRRRQLAPENGBasic
100-130LDKNFLQRPQKERKKKPRDNIKKKSENSLNSHydrophilic
NLS Segment(s)
PositionSequence
107-123RPQKERKKKPRDNIKKK
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYYVIYFFFKKKILYILFLTYNYNFCTIISRTSKNSLKMDDIINSMKERKNEKQNTDINLSLGEKPKREHRRRQLAPENGLGIIDAELKNQDMNDNKKELDKNFLQRPQKERKKKPRDNIKKKSENSLNSNTSSEDIQAPKPKVTERVLSNEGIINIFIFLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.35
4 0.35
5 0.34
6 0.35
7 0.28
8 0.28
9 0.24
10 0.23
11 0.17
12 0.15
13 0.19
14 0.17
15 0.23
16 0.27
17 0.29
18 0.31
19 0.39
20 0.44
21 0.45
22 0.48
23 0.43
24 0.41
25 0.4
26 0.39
27 0.33
28 0.31
29 0.27
30 0.25
31 0.24
32 0.25
33 0.25
34 0.27
35 0.32
36 0.36
37 0.45
38 0.51
39 0.54
40 0.59
41 0.61
42 0.61
43 0.59
44 0.52
45 0.41
46 0.34
47 0.31
48 0.26
49 0.26
50 0.24
51 0.21
52 0.22
53 0.32
54 0.42
55 0.48
56 0.56
57 0.6
58 0.69
59 0.73
60 0.81
61 0.81
62 0.76
63 0.71
64 0.62
65 0.52
66 0.41
67 0.35
68 0.25
69 0.16
70 0.09
71 0.08
72 0.06
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.08
79 0.12
80 0.17
81 0.19
82 0.21
83 0.21
84 0.26
85 0.29
86 0.27
87 0.29
88 0.29
89 0.33
90 0.39
91 0.46
92 0.49
93 0.51
94 0.58
95 0.63
96 0.68
97 0.72
98 0.76
99 0.8
100 0.84
101 0.89
102 0.92
103 0.92
104 0.93
105 0.94
106 0.93
107 0.93
108 0.92
109 0.84
110 0.84
111 0.81
112 0.76
113 0.72
114 0.7
115 0.63
116 0.55
117 0.54
118 0.45
119 0.37
120 0.3
121 0.24
122 0.2
123 0.19
124 0.23
125 0.3
126 0.31
127 0.32
128 0.34
129 0.36
130 0.38
131 0.4
132 0.42
133 0.38
134 0.44
135 0.45
136 0.43
137 0.42
138 0.38
139 0.34
140 0.27
141 0.22
142 0.14