Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2APJ4

Protein Details
Accession A0A1Y2APJ4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-27KEDSNKGKLKKEFKNESKTKBasic
NLS Segment(s)
PositionSequence
13-18KGKLKK
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 11, cyto_nucl 8.166
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEKKNLRKEDSNKGKLKKEFKNESKTKNIVSALFKMLFHGVLFYFSASYLITNTFTWGKKFPNWRRYIPVFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.78
4 0.75
5 0.75
6 0.76
7 0.76
8 0.8
9 0.79
10 0.77
11 0.76
12 0.71
13 0.61
14 0.55
15 0.48
16 0.41
17 0.37
18 0.32
19 0.27
20 0.25
21 0.23
22 0.19
23 0.18
24 0.14
25 0.11
26 0.09
27 0.06
28 0.06
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.07
38 0.08
39 0.08
40 0.11
41 0.15
42 0.16
43 0.19
44 0.21
45 0.24
46 0.3
47 0.41
48 0.49
49 0.55
50 0.6
51 0.64
52 0.7