Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2D668

Protein Details
Accession A0A1Y2D668    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-39IENKKNIKDLPKYQKPKRNPPVRLPKKSRIPRDVLHydrophilic
NLS Segment(s)
PositionSequence
12-34KDLPKYQKPKRNPPVRLPKKSRI
Subcellular Location(s) plas 10, nucl 8, cyto_nucl 6, E.R. 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019013  Vma21  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0033116  C:endoplasmic reticulum-Golgi intermediate compartment membrane  
GO:0012507  C:ER to Golgi transport vesicle membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF09446  VMA21  
Amino Acid Sequences MGSAIENKKNIKDLPKYQKPKRNPPVRLPKKSRIPRDVLLKLIIFTALMFSLPFITYFFTLDRFFLGNTTYAALSAALVANVIVVAYVIVAIVEDKDDEDNVDSNKKSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.67
3 0.74
4 0.79
5 0.85
6 0.85
7 0.87
8 0.88
9 0.87
10 0.84
11 0.85
12 0.86
13 0.88
14 0.89
15 0.86
16 0.85
17 0.85
18 0.87
19 0.86
20 0.81
21 0.77
22 0.71
23 0.72
24 0.65
25 0.56
26 0.5
27 0.4
28 0.33
29 0.27
30 0.21
31 0.11
32 0.08
33 0.07
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.04
42 0.05
43 0.06
44 0.07
45 0.07
46 0.08
47 0.09
48 0.09
49 0.1
50 0.09
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.09
57 0.08
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.04
81 0.04
82 0.05
83 0.06
84 0.07
85 0.08
86 0.1
87 0.13
88 0.15
89 0.21