Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ADT2

Protein Details
Accession A0A1Y2ADT2   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
218-252GSSVYYSKRQLRKFERKAKRNFRKQKRINKNKSSLHydrophilic
NLS Segment(s)
PositionSequence
225-250KRQLRKFERKAKRNFRKQKRINKNKS
Subcellular Location(s) E.R. 6, golg 5, nucl 4, mito 3, pero 3, plas 2, extr 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001173  Glyco_trans_2-like  
IPR029044  Nucleotide-diphossugar_trans  
Pfam View protein in Pfam  
PF00535  Glycos_transf_2  
CDD cd00761  Glyco_tranf_GTA_type  
Amino Acid Sequences MKLFKCIFLITYLSLLVFLKSTFALPLSIIVPVYNVSPYLDRCIKSILNQTFKDYEVIFVDDASTDNSLEILKKYKETDNRIKIIHLEINKGAGAARNIGMDIAEGEFIGFVDSDDYIDEPFFETLMKNSYDNDIVVGRVAMSTNISDYYTKEEPTTWAVYDKIWRKTFIKNHNIRFNEVMRHGGDDIEFNNVAYTFNPKILKLPDEGIYYYYKRRTGSSVYYSKRQLRKFERKAKRNFRKQKRINKNKSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.11
4 0.09
5 0.08
6 0.08
7 0.08
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.11
14 0.1
15 0.1
16 0.1
17 0.09
18 0.09
19 0.09
20 0.09
21 0.08
22 0.08
23 0.08
24 0.11
25 0.13
26 0.19
27 0.24
28 0.23
29 0.24
30 0.29
31 0.28
32 0.3
33 0.39
34 0.4
35 0.43
36 0.43
37 0.46
38 0.43
39 0.43
40 0.4
41 0.31
42 0.25
43 0.18
44 0.19
45 0.15
46 0.13
47 0.12
48 0.1
49 0.1
50 0.1
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.09
58 0.13
59 0.13
60 0.16
61 0.19
62 0.25
63 0.33
64 0.4
65 0.49
66 0.52
67 0.55
68 0.53
69 0.51
70 0.46
71 0.42
72 0.38
73 0.29
74 0.24
75 0.2
76 0.21
77 0.2
78 0.18
79 0.15
80 0.12
81 0.11
82 0.09
83 0.09
84 0.08
85 0.08
86 0.08
87 0.08
88 0.06
89 0.05
90 0.04
91 0.04
92 0.04
93 0.03
94 0.03
95 0.03
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.07
114 0.08
115 0.08
116 0.08
117 0.1
118 0.1
119 0.1
120 0.1
121 0.08
122 0.07
123 0.07
124 0.06
125 0.05
126 0.04
127 0.05
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.06
134 0.07
135 0.07
136 0.13
137 0.14
138 0.14
139 0.14
140 0.14
141 0.15
142 0.18
143 0.2
144 0.14
145 0.14
146 0.14
147 0.15
148 0.21
149 0.26
150 0.31
151 0.31
152 0.34
153 0.35
154 0.43
155 0.51
156 0.54
157 0.58
158 0.58
159 0.65
160 0.71
161 0.7
162 0.65
163 0.6
164 0.53
165 0.48
166 0.4
167 0.36
168 0.27
169 0.27
170 0.24
171 0.2
172 0.18
173 0.13
174 0.13
175 0.13
176 0.13
177 0.1
178 0.11
179 0.1
180 0.11
181 0.1
182 0.15
183 0.12
184 0.17
185 0.18
186 0.18
187 0.22
188 0.25
189 0.27
190 0.24
191 0.26
192 0.25
193 0.26
194 0.27
195 0.24
196 0.25
197 0.25
198 0.29
199 0.31
200 0.3
201 0.29
202 0.31
203 0.34
204 0.36
205 0.41
206 0.45
207 0.5
208 0.52
209 0.57
210 0.62
211 0.67
212 0.69
213 0.67
214 0.68
215 0.69
216 0.76
217 0.8
218 0.84
219 0.86
220 0.87
221 0.93
222 0.94
223 0.94
224 0.94
225 0.94
226 0.94
227 0.95
228 0.95
229 0.95
230 0.95
231 0.95
232 0.95