Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BER6

Protein Details
Accession A0A1Y2BER6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
224-248QARAMYKSNRAKPKTKNSWKSSSNIHydrophilic
NLS Segment(s)
PositionSequence
155-172KSRKISRAERKRGSKVWK
Subcellular Location(s) nucl 19, cyto_nucl 12.666, mito_nucl 12.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
Amino Acid Sequences MTSNNTCDPFEKLNVRVKGAPRNYTIIHHILFEFTPRELAQMERVSKSWNKAINSDTELWWNKWMSLVWGQKNIMGTTPAPKLSEANLRDLAILQNSLTFSELNSSTLGVNSDMDIDSDNVSYASSVVTLTDVSSCGGDINYIAKKANSVSSLNKSRKISRAERKRGSKVWKRLTIDEYRKQEVRNVFVSPDNDESDSDDTVINQEKSSTSNVRGKLTTEEKVQARAMYKSNRAKPKTKNSWKSSSNISKEWMAFEDYYDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.5
4 0.51
5 0.55
6 0.56
7 0.56
8 0.5
9 0.52
10 0.49
11 0.47
12 0.47
13 0.41
14 0.35
15 0.31
16 0.28
17 0.24
18 0.23
19 0.22
20 0.19
21 0.14
22 0.16
23 0.15
24 0.16
25 0.15
26 0.16
27 0.19
28 0.24
29 0.27
30 0.26
31 0.27
32 0.31
33 0.33
34 0.37
35 0.37
36 0.36
37 0.35
38 0.36
39 0.38
40 0.38
41 0.39
42 0.37
43 0.31
44 0.33
45 0.34
46 0.32
47 0.34
48 0.29
49 0.24
50 0.24
51 0.23
52 0.19
53 0.24
54 0.3
55 0.3
56 0.34
57 0.34
58 0.34
59 0.36
60 0.32
61 0.25
62 0.19
63 0.17
64 0.16
65 0.18
66 0.18
67 0.17
68 0.17
69 0.17
70 0.18
71 0.26
72 0.22
73 0.25
74 0.25
75 0.25
76 0.24
77 0.24
78 0.22
79 0.14
80 0.13
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.07
87 0.06
88 0.09
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.1
96 0.07
97 0.07
98 0.06
99 0.07
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.07
128 0.07
129 0.08
130 0.08
131 0.08
132 0.09
133 0.1
134 0.12
135 0.12
136 0.13
137 0.17
138 0.24
139 0.33
140 0.35
141 0.4
142 0.41
143 0.43
144 0.47
145 0.5
146 0.52
147 0.54
148 0.62
149 0.67
150 0.73
151 0.77
152 0.77
153 0.77
154 0.78
155 0.77
156 0.76
157 0.76
158 0.75
159 0.71
160 0.68
161 0.67
162 0.67
163 0.65
164 0.63
165 0.59
166 0.56
167 0.54
168 0.5
169 0.5
170 0.44
171 0.4
172 0.34
173 0.3
174 0.27
175 0.29
176 0.29
177 0.27
178 0.25
179 0.23
180 0.21
181 0.2
182 0.21
183 0.2
184 0.19
185 0.16
186 0.13
187 0.12
188 0.13
189 0.18
190 0.15
191 0.13
192 0.14
193 0.14
194 0.16
195 0.21
196 0.22
197 0.23
198 0.29
199 0.32
200 0.35
201 0.35
202 0.35
203 0.38
204 0.4
205 0.37
206 0.35
207 0.39
208 0.37
209 0.4
210 0.39
211 0.35
212 0.33
213 0.33
214 0.36
215 0.36
216 0.44
217 0.5
218 0.57
219 0.64
220 0.67
221 0.72
222 0.76
223 0.8
224 0.82
225 0.84
226 0.85
227 0.83
228 0.87
229 0.82
230 0.76
231 0.75
232 0.74
233 0.69
234 0.62
235 0.58
236 0.53
237 0.5
238 0.49
239 0.4
240 0.34
241 0.28