Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AIZ6

Protein Details
Accession A0A1Y2AIZ6   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
167-188KYCIWHYKKSLEIKKNKLCYNEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018289  MULE_transposase_dom  
Pfam View protein in Pfam  
PF10551  MULE  
Amino Acid Sequences MGLICPEYNSIKSQISRNLNKKLPSNVTTFAEIPSESEYYRTKRGENFMIFKNSNLIIFQSPFQAKLFSEYNDDIFVDGTFFIAPKFSYQVFITRTYAKELDSFYTTSFAILKNKEQETYKMLFEKLKKNANTCNNNIRIEPKNLHCDFERAISKAAKTIFPNTNIKYCIWHYKKSLEIKKNKLCYNELFQIYHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.54
4 0.6
5 0.65
6 0.66
7 0.68
8 0.68
9 0.68
10 0.66
11 0.59
12 0.56
13 0.51
14 0.48
15 0.46
16 0.41
17 0.33
18 0.27
19 0.23
20 0.19
21 0.18
22 0.16
23 0.13
24 0.16
25 0.19
26 0.22
27 0.29
28 0.29
29 0.29
30 0.33
31 0.39
32 0.44
33 0.45
34 0.46
35 0.44
36 0.5
37 0.47
38 0.42
39 0.4
40 0.32
41 0.26
42 0.22
43 0.19
44 0.13
45 0.14
46 0.14
47 0.16
48 0.16
49 0.17
50 0.17
51 0.16
52 0.14
53 0.17
54 0.19
55 0.15
56 0.18
57 0.18
58 0.18
59 0.18
60 0.17
61 0.13
62 0.12
63 0.1
64 0.07
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.07
74 0.07
75 0.09
76 0.1
77 0.14
78 0.16
79 0.18
80 0.2
81 0.2
82 0.2
83 0.21
84 0.21
85 0.17
86 0.17
87 0.15
88 0.15
89 0.15
90 0.15
91 0.12
92 0.13
93 0.12
94 0.11
95 0.1
96 0.1
97 0.12
98 0.13
99 0.16
100 0.2
101 0.21
102 0.23
103 0.24
104 0.25
105 0.26
106 0.27
107 0.26
108 0.22
109 0.23
110 0.25
111 0.28
112 0.34
113 0.35
114 0.41
115 0.42
116 0.43
117 0.51
118 0.56
119 0.58
120 0.55
121 0.58
122 0.55
123 0.54
124 0.51
125 0.48
126 0.43
127 0.42
128 0.42
129 0.37
130 0.42
131 0.41
132 0.43
133 0.38
134 0.37
135 0.33
136 0.35
137 0.34
138 0.26
139 0.29
140 0.28
141 0.28
142 0.29
143 0.29
144 0.26
145 0.25
146 0.31
147 0.32
148 0.36
149 0.43
150 0.42
151 0.46
152 0.43
153 0.41
154 0.39
155 0.38
156 0.43
157 0.41
158 0.44
159 0.43
160 0.48
161 0.55
162 0.61
163 0.67
164 0.66
165 0.71
166 0.75
167 0.81
168 0.83
169 0.8
170 0.75
171 0.7
172 0.66
173 0.65
174 0.63
175 0.57