Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AFX3

Protein Details
Accession A0A1Y2AFX3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
103-135LKIKHTKTFKGSKRKESRKNKEKKEINIKIDESBasic
NLS Segment(s)
PositionSequence
106-126KHTKTFKGSKRKESRKNKEKK
Subcellular Location(s) nucl 10, cyto 9, mito 6
Family & Domain DBs
Amino Acid Sequences MKKIHNAQEIIAVEKIQKAWKNYRETRYELFPYNEKALTLPAIEIGHVNDVFKNVLDSNDEIEVDNWLHNEINYDYDDKMNNYLNQSEMTIELNINQNIPINLKIKHTKTFKGSKRKESRKNKEKKEINIKIDESNITIYEENKVDIPERNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.21
4 0.25
5 0.28
6 0.37
7 0.44
8 0.53
9 0.6
10 0.66
11 0.65
12 0.67
13 0.64
14 0.61
15 0.58
16 0.53
17 0.48
18 0.44
19 0.42
20 0.4
21 0.37
22 0.3
23 0.26
24 0.22
25 0.19
26 0.16
27 0.11
28 0.1
29 0.09
30 0.09
31 0.09
32 0.09
33 0.1
34 0.1
35 0.1
36 0.08
37 0.09
38 0.1
39 0.09
40 0.1
41 0.07
42 0.08
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.1
49 0.1
50 0.1
51 0.09
52 0.08
53 0.07
54 0.07
55 0.07
56 0.06
57 0.08
58 0.07
59 0.08
60 0.09
61 0.1
62 0.1
63 0.11
64 0.12
65 0.1
66 0.12
67 0.13
68 0.13
69 0.13
70 0.13
71 0.13
72 0.13
73 0.12
74 0.11
75 0.09
76 0.09
77 0.08
78 0.08
79 0.09
80 0.12
81 0.12
82 0.11
83 0.11
84 0.11
85 0.11
86 0.12
87 0.14
88 0.13
89 0.15
90 0.19
91 0.26
92 0.28
93 0.36
94 0.39
95 0.4
96 0.46
97 0.54
98 0.58
99 0.63
100 0.67
101 0.7
102 0.77
103 0.83
104 0.86
105 0.88
106 0.91
107 0.9
108 0.93
109 0.92
110 0.92
111 0.89
112 0.89
113 0.89
114 0.87
115 0.83
116 0.8
117 0.72
118 0.64
119 0.58
120 0.49
121 0.39
122 0.31
123 0.25
124 0.2
125 0.19
126 0.17
127 0.18
128 0.18
129 0.17
130 0.17
131 0.17
132 0.17
133 0.24