Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YWZ3

Protein Details
Accession A0A1Y1YWZ3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
14-34QEDPKDQKKTVQIKNIRKIFKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003439  ABC_transporter-like_ATP-bd  
IPR026082  ABCA  
IPR003959  ATPase_AAA_core  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016020  C:membrane  
GO:0140359  F:ABC-type transporter activity  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF13304  AAA_21  
PF00005  ABC_tran  
PROSITE View protein in PROSITE  
PS50893  ABC_TRANSPORTER_2  
Amino Acid Sequences MDSRHDNTFNPYIQEDPKDQKKTVQIKNIRKIFKVKGESIEILQNINFNAYYNEIFAILGHNGAGKTTLMNIMTGIISSTSGEIYYDNIPISGIHVDIDSVLKNIDLLSKKNNFPKELSGGQRRKLCITLAFLGSPKYVFLDEPTTGLDPYSRKNIWELLLEKKEGRTIFVTTHYMDEADLLADRKMIISNGKISCLGSSLFLKQQFNMNYSIDINCKDIRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.38
4 0.46
5 0.48
6 0.48
7 0.5
8 0.56
9 0.62
10 0.64
11 0.66
12 0.67
13 0.71
14 0.81
15 0.83
16 0.78
17 0.71
18 0.7
19 0.67
20 0.66
21 0.63
22 0.57
23 0.53
24 0.54
25 0.52
26 0.46
27 0.44
28 0.34
29 0.28
30 0.25
31 0.21
32 0.15
33 0.15
34 0.13
35 0.09
36 0.09
37 0.11
38 0.11
39 0.1
40 0.11
41 0.1
42 0.1
43 0.09
44 0.1
45 0.08
46 0.07
47 0.06
48 0.07
49 0.07
50 0.07
51 0.08
52 0.06
53 0.06
54 0.07
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.05
64 0.05
65 0.05
66 0.05
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.07
73 0.08
74 0.08
75 0.07
76 0.08
77 0.07
78 0.09
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.08
93 0.09
94 0.1
95 0.16
96 0.2
97 0.23
98 0.29
99 0.32
100 0.29
101 0.3
102 0.31
103 0.31
104 0.32
105 0.34
106 0.39
107 0.4
108 0.43
109 0.45
110 0.43
111 0.4
112 0.36
113 0.32
114 0.24
115 0.24
116 0.22
117 0.19
118 0.19
119 0.17
120 0.17
121 0.16
122 0.13
123 0.1
124 0.08
125 0.07
126 0.07
127 0.08
128 0.11
129 0.11
130 0.12
131 0.14
132 0.13
133 0.13
134 0.13
135 0.13
136 0.11
137 0.13
138 0.19
139 0.18
140 0.18
141 0.2
142 0.23
143 0.22
144 0.27
145 0.27
146 0.28
147 0.31
148 0.32
149 0.31
150 0.29
151 0.32
152 0.26
153 0.26
154 0.2
155 0.19
156 0.19
157 0.22
158 0.24
159 0.21
160 0.22
161 0.19
162 0.17
163 0.15
164 0.14
165 0.1
166 0.08
167 0.08
168 0.08
169 0.07
170 0.08
171 0.08
172 0.08
173 0.08
174 0.09
175 0.11
176 0.13
177 0.21
178 0.22
179 0.24
180 0.24
181 0.23
182 0.22
183 0.21
184 0.18
185 0.14
186 0.15
187 0.17
188 0.22
189 0.26
190 0.27
191 0.27
192 0.34
193 0.34
194 0.34
195 0.34
196 0.3
197 0.27
198 0.28
199 0.3
200 0.25
201 0.23
202 0.25