Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2APD9

Protein Details
Accession A0A1Y2APD9    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-36KVNIPKTRKTFCKGKKCRKHTLHKVTQYKTGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MCINKVNIPKTRKTFCKGKKCRKHTLHKVTQYKTGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKIVLRLECTVCKYKQQLAIKRCKHFELGGEKKTKGAALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.78
4 0.8
5 0.83
6 0.85
7 0.86
8 0.91
9 0.9
10 0.91
11 0.91
12 0.91
13 0.9
14 0.89
15 0.9
16 0.82
17 0.81
18 0.75
19 0.66
20 0.58
21 0.52
22 0.42
23 0.35
24 0.35
25 0.33
26 0.35
27 0.35
28 0.4
29 0.42
30 0.46
31 0.5
32 0.54
33 0.51
34 0.55
35 0.61
36 0.58
37 0.6
38 0.58
39 0.57
40 0.55
41 0.54
42 0.47
43 0.4
44 0.37
45 0.3
46 0.31
47 0.31
48 0.3
49 0.29
50 0.33
51 0.39
52 0.48
53 0.56
54 0.6
55 0.61
56 0.65
57 0.72
58 0.72
59 0.71
60 0.68
61 0.63
62 0.6
63 0.58
64 0.53
65 0.48
66 0.45
67 0.39
68 0.38
69 0.37
70 0.37
71 0.41
72 0.48
73 0.53
74 0.57
75 0.67
76 0.7
77 0.73
78 0.71
79 0.65
80 0.6
81 0.52
82 0.51
83 0.51
84 0.52
85 0.52
86 0.54
87 0.52
88 0.49
89 0.48
90 0.42